PDB entry 5lp1

View 5lp1 on RCSB PDB site
Description: crystal structure of human lipoprotein-associated phospholipase a2 in complex with a [1.1.1]bicyclopentane-containing inhibitor at 1.91a resolution.
Deposited on 2016-08-11, released 2017-02-01
The last revision was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G7, PAFAH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, 71H, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lp1A (A:)
    maaasfgqtkiprgngpysvgctdlmfdhtnkgtflrlyypsqdndrldtlwipnkeyfw
    glskflgthwlmgnilrllfgsmttpanwnsplrpgekyplvvfshglgafrtlysaigi
    dlashgfivaavehrdrsasatyyfkdqsaaeigdkswlylrtlkqeeethirneqvrqr
    akecsqalslildidhgkpvknaldlkfdmeqlkdsidrekiavighsfggatviqtlse
    dqrfrcgialdawmfplgdevysripqplffinseyfqypaniikmkkcyspdkerkmit
    irgsvhqnfadftfatgkiighmlklkgdidsnvaidlsnkaslaflqkhlglhkdfdqw
    dcliegddenlipgtninttnqhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lp1A (A:)
    kiprgngpysvgctdlmfdhtnkgtflrlyypsqdndrldtlwipnkeyfwglskflgth
    wlmgnilrllfgsmttpanwnsplrpgekyplvvfshglgafrtlysaigidlashgfiv
    aavehrdrsasatyyfkdqsaaeigdkswlylrtlkqeeethirneqvrqrakecsqals
    lildidhgkpvknaldlkfdmeqlkdsidrekiavighsfggatviqtlsedqrfrcgia
    ldawmfplgdevysripqplffinseyfqypaniikmkkcyspdkerkmitirgsvhqnf
    adftfatgkiighmlklkgdidsnvaidlsnkaslaflqkhlglhkdfdqwdcliegdde
    nlipgtnint