PDB entry 5loz

View 5loz on RCSB PDB site
Description: structure of yeast ent1 enth domain
Class: ubiquitin-binding domain
Keywords: alpha-alpha superhelix, ubiquitin receptor, endocytosis adaptor, ubiquitin, clathrin, lipid, eps15, ubiquitin-binding domain
Deposited on 2016-08-11, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epsin-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: ENT1, YDL161W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12518 (3-136)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5loza1, d5loza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lozA (A:)
    mgssstqvlvrnatsndnhqvskdslielaeksydsadffeimdmldkrlndkgkywrhi
    akaltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgqivrvkakeltall
    sdderlneernmnikgr