PDB entry 5loy

View 5loy on RCSB PDB site
Description: helical assembly of a designed anbu protein
Deposited on 2016-08-10, released 2017-06-07
The last revision was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Designed Anbu Protein
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LOY (0-End)
  • Chain 'B':
    Compound: Designed Anbu Protein
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LOY (0-End)
  • Chain 'C':
    Compound: Designed Anbu Protein
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LOY (0-End)
  • Chain 'D':
    Compound: Designed Anbu Protein
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LOY (0-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5loyA (A:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardapaleadgvdfnasfilggqiag
    epprlfliypagnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdst
    mrsnlsvglpldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppwe
    

    Sequence, based on observed residues (ATOM records):
    >5loyA (A:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardfnasfilggqiagepprlfliyp
    agnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdstmrsnlsvglp
    ldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppw
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5loyB (B:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardapaleadgvdfnasfilggqiag
    epprlfliypagnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdst
    mrsnlsvglpldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppwe
    

    Sequence, based on observed residues (ATOM records):
    >5loyB (B:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardfnasfilggqiagepprlfliyp
    agnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdstmrsnlsvglp
    ldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppw
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5loyC (C:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardapaleadgvdfnasfilggqiag
    epprlfliypagnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdst
    mrsnlsvglpldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppwe
    

    Sequence, based on observed residues (ATOM records):
    >5loyC (C:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardfnasfilggqiagepprlfliyp
    agnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdstmrsnlsvglp
    ldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppw
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5loyD (D:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardapaleadgvdfnasfilggqiag
    epprlfliypagnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdst
    mrsnlsvglpldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppwe
    

    Sequence, based on observed residues (ATOM records):
    >5loyD (D:)
    tycvgirldeglvfasdsrtnagvdnistfrkmhvfevpgervivlltagnlattqavis
    lleerlkdpeerlltapsmfeaarlvgealrevqardfnasfilggqiagepprlfliyp
    agnfieatpdtpffqigetkygkpildrvitpdtsledaakcalvsfdstmrsnlsvglp
    ldllvyerdslrvghrrrideddpyfrmlrkqwseglrqafdslpdppw