PDB entry 5loi

View 5loi on RCSB PDB site
Description: crystal structure of myceliophthora thermophila rad26 (residues 373- 841)
Deposited on 2016-08-09, released 2017-03-29
The last revision was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rad26
    Species: Myceliophthora thermophila ATCC 42464 [TaxId:573729]
    Gene: MYCTH_2305697
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5loiA (A:)
    spdflklflnhttmhgqpptfdmfsrfcfpsdperslasivlqklpqmgspgdptsllvd
    fadtlidlwhqclseryygpiyhlvslllytldlnavevaphilsslipvcattcrlval
    prlnsadgdlsghpdavvrqlclnidvtqclsvlylaasgclpqplqnptssdqpqdtpq
    lefwktmeldfvltmlspknpeedwsammillrtsvaphsigpipssatnstnrrseakn
    adavaatlidcvssflceppkwatprsakeiaarlaalrtlmafatghfgarqiaesdva
    iprlvtvlcwaldrlydsdlplspepqagagrppdergdsmeldhpnvesaggmeahgts
    egltdvsaevtdaapdsmsllhqiiaqgtrllhflvtdhrtsdaanistklaashggsqr
    yfltlarlnfaeedlvleagidaetvelahellelavtpdegdeisemfd
    

    Sequence, based on observed residues (ATOM records):
    >5loiA (A:)
    pdflklflnhtptfdmfsrfcfpsdperslasivlqklpqmgspgdptsllvdfadtlid
    lwhqclseryygpiyhlvslllytldlnavevaphilsslipvcattcrlvalprlnsad
    gdlsghpdavvrqlclnidvtqclsvlylaasgclpqplpqdtpqlefwktmeldfvltm
    lspknpeedwsammillrtsvaphsigpipssatnstnrrseaknadavaatlidcvssf
    lceppkwatprsakeiaarlaalrtlmafatghfgarqiaesdvaiprlvtvlcwaldrl
    ydsdlppdsmsllhqiiaqgtrllhflvtdhrtsdaanistklaashggsqryfltlarl
    nfaeedlvleagidaetvelahellelavtp