PDB entry 5loh

View 5loh on RCSB PDB site
Description: Kinase domain of human Greatwall
Class: transferase
Keywords: Kinase domain, Inhibitor, transferase
Deposited on 2016-08-09, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase greatwall,Serine/threonine-protein kinase greatwall
    Species: Homo sapiens [TaxId:9606]
    Gene: MASTL, GW, GWL, THC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5loha_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase greatwall,Serine/threonine-protein kinase greatwall
    Species: Homo sapiens [TaxId:9606]
    Gene: MASTL, GW, GWL, THC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lohb_
  • Heterogens: STU, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lohA (A:)
    gphmdptagskkepgggaateegvnriavpkppsieefsivkpisrgafgkvylgqkggk
    lyavkvvkkadminknmthqvqaerdalalskspfivhlyyslqsannvylvmeyliggd
    vksllhiygyfdeemavkyisevalaldylhrhgiihrdlkpdnmlisneghikltdfgl
    skvtlnrdinmmdilttrtfcgtpdylapelllgrahgpavdwwalgvclfefltgippf
    ndetpqqvfqnilkrdipwpegeeklsdnaqsaveilltiddtkragmkelkrhplfsdv
    dwenlqhqtmpfipqpddetdtsyfearntaqhltvsgfsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lohA (A:)
    psieefsivkpisgkvylgqkggklyavkvvkkadmlalskspfivhlyyslqsannvyl
    vmeyliggdvksllhiygyfdeemavkyisevalaldylhrhgiihrdlkpdnmlisneg
    hikltdfglskfcgtpdylapelllgrahgpavdwwalgvclfefltgippfndetpqqv
    fqnilkrdipwpegeeklsdnaqsaveilltiddtkragmkelkrhplfsdvdwenlqhq
    tmpfipqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lohB (B:)
    gphmdptagskkepgggaateegvnriavpkppsieefsivkpisrgafgkvylgqkggk
    lyavkvvkkadminknmthqvqaerdalalskspfivhlyyslqsannvylvmeyliggd
    vksllhiygyfdeemavkyisevalaldylhrhgiihrdlkpdnmlisneghikltdfgl
    skvtlnrdinmmdilttrtfcgtpdylapelllgrahgpavdwwalgvclfefltgippf
    ndetpqqvfqnilkrdipwpegeeklsdnaqsaveilltiddtkragmkelkrhplfsdv
    dwenlqhqtmpfipqpddetdtsyfearntaqhltvsgfsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lohB (B:)
    psieefsivkpisrgafgkvylgqkggklyavkvvkkadminkalskspfivhlyyslqs
    annvylvmeyliggdvksllhiygyfdeemavkyisevalaldylhrhgiihrdlkpdnm
    lisneghikltdfglgtpdylapelllgrahgpavdwwalgvclfefltgippfndetpq
    qvfqnilkrdipwpegeeklsdnaqsaveilltiddtkragmkelkrhplfsdvdwenlq
    hqtmpfipqp