PDB entry 5lod

View 5lod on RCSB PDB site
Description: Crystal structure of HhaI DNA methyltransferase in APO form
Class: transferase
Keywords: M.HhaI, C5-METHYLCYTOSINE, APO FORM, DNA methyltransferase, transferase
Deposited on 2016-08-09, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus parahaemolyticus [TaxId:735]
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5loda_
  • Chain 'B':
    Compound: modification methylase hhai
    Species: Haemophilus parahaemolyticus [TaxId:735]
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lodb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lodA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lodA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsgfedsrgtlffdiarivrekkpkvvfmenvknfas
    hdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnfqfpkpf
    elntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqgeriystrg
    iaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqaykqfgnsv
    vinvlqyiaynigsslnfkpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lodB (B:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lodB (B:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsgfedsrgtlffdiarivrekkpkvvfmenvknfas
    hdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnfqfpkpf
    elntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqgeriystrg
    iaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqaykqfgnsv
    vinvlqyiaynigsslnfkpy