PDB entry 5loa

View 5loa on RCSB PDB site
Description: crystal structure of the engineered d-amino acid dehydrogenase (daadh) bound to nadp+
Deposited on 2016-08-09, released 2017-08-16
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: meso-diaminopimelate d-dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: ddh, Cgl2617, cg2900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04964 (0-318)
      • conflict (148)
      • conflict (152)
      • conflict (167)
      • conflict (193)
      • conflict (242)
  • Chain 'B':
    Compound: meso-diaminopimelate d-dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: ddh, Cgl2617, cg2900
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04964 (0-318)
      • conflict (148)
      • conflict (152)
      • conflict (167)
      • conflict (193)
      • conflict (242)
  • Heterogens: NAP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5loaA (A:)
    tnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvdv
    lflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgwdp
    gmfsinrvyaaavlaehqqhtfwgpglslghsgalrripgvqkavqyilpsedalekarr
    geagdltgkqthkmqcfvvadaadheriendirtmpdyfvgyevevnfideatfdsehtg
    mpngghvittgdtggfnhtveyilkldrnpdftassqiafgraahrmkqqgqsgaftvle
    vapyllspenlddliardv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5loaB (B:)
    tnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvdv
    lflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgwdp
    gmfsinrvyaaavlaehqqhtfwgpglslghsgalrripgvqkavqyilpsedalekarr
    geagdltgkqthkmqcfvvadaadheriendirtmpdyfvgyevevnfideatfdsehtg
    mpngghvittgdtggfnhtveyilkldrnpdftassqiafgraahrmkqqgqsgaftvle
    vapyllspenlddliardv