PDB entry 5lns

View 5lns on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana Pdx1-R5P complex
Class: lyase
Keywords: beta/alpha barrel, pyridoxal phosphate synthase, glutamine amidotransferase, vitamin B6 biosynthesis, LYASE
Deposited on 2016-08-06, released 2017-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lnsa_
  • Chain 'B':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lnsb_
  • Chain 'C':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lnsc_
  • Chain 'D':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lnsd_
  • Heterogens: 5RP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lnsA (A:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnsA (A:)
    spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
    qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
    fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
    fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
    arraraivqavthysdpemlvevscglgeamvgin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lnsB (B:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnsB (B:)
    kspfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsd
    pqmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfri
    pfvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevf
    tfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgd
    parraraivqavthysdpemlvevscglgeamvgin
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lnsC (C:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnsC (C:)
    spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
    qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
    fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
    fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
    arraraivqavthysdpemlvevscglgeamvgin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lnsD (D:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnsD (D:)
    spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
    qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
    fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
    fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
    arraraivqavthysdpemlvevscglgeamvg