PDB entry 5lnq

View 5lnq on RCSB PDB site
Description: crystal structure of scp2 thiolase from leishmania mexicana. complex of the c123a mutant with acetoacetyl-coa.
Deposited on 2016-08-06, released 2017-01-18
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-ketoacyl-coa thiolase-like protein
    Species: Leishmania mexicana [TaxId:5665]
    Gene: LMXM_23_0690
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AW84 (Start-456)
      • conflict (27)
      • conflict (46)
      • conflict (49)
      • conflict (60)
      • conflict (74)
      • conflict (76)
      • conflict (78-80)
      • conflict (82)
      • conflict (84)
      • conflict (86)
      • conflict (122)
      • conflict (127)
      • engineered mutation (138)
      • conflict (149)
      • conflict (154)
      • conflict (160)
      • conflict (172)
      • conflict (191)
      • conflict (244)
      • conflict (283)
      • conflict (292)
      • conflict (342)
      • conflict (371)
      • conflict (383)
      • conflict (413)
      • conflict (425)
  • Chain 'B':
    Compound: 3-ketoacyl-coa thiolase-like protein
    Species: Leishmania mexicana [TaxId:5665]
    Gene: LMXM_23_0690
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AW84 (Start-456)
      • conflict (27)
      • conflict (46)
      • conflict (49)
      • conflict (60)
      • conflict (74)
      • conflict (76)
      • conflict (78-80)
      • conflict (82)
      • conflict (84)
      • conflict (86)
      • conflict (122)
      • conflict (127)
      • engineered mutation (138)
      • conflict (149)
      • conflict (154)
      • conflict (160)
      • conflict (172)
      • conflict (191)
      • conflict (244)
      • conflict (283)
      • conflict (292)
      • conflict (342)
      • conflict (371)
      • conflict (383)
      • conflict (413)
      • conflict (425)
  • Chain 'C':
    Compound: 3-ketoacyl-coa thiolase-like protein
    Species: Leishmania mexicana [TaxId:5665]
    Gene: LMXM_23_0690
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AW84 (Start-456)
      • conflict (27)
      • conflict (46)
      • conflict (49)
      • conflict (60)
      • conflict (74)
      • conflict (76)
      • conflict (78-80)
      • conflict (82)
      • conflict (84)
      • conflict (86)
      • conflict (122)
      • conflict (127)
      • engineered mutation (138)
      • conflict (149)
      • conflict (154)
      • conflict (160)
      • conflict (172)
      • conflict (191)
      • conflict (244)
      • conflict (283)
      • conflict (292)
      • conflict (342)
      • conflict (371)
      • conflict (383)
      • conflict (413)
      • conflict (425)
  • Chain 'D':
    Compound: 3-ketoacyl-coa thiolase-like protein
    Species: Leishmania mexicana [TaxId:5665]
    Gene: LMXM_23_0690
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AW84 (Start-456)
      • conflict (27)
      • conflict (46)
      • conflict (49)
      • conflict (60)
      • conflict (74)
      • conflict (76)
      • conflict (78-80)
      • conflict (82)
      • conflict (84)
      • conflict (86)
      • conflict (122)
      • conflict (127)
      • engineered mutation (138)
      • conflict (149)
      • conflict (154)
      • conflict (160)
      • conflict (172)
      • conflict (191)
      • conflict (244)
      • conflict (283)
      • conflict (292)
      • conflict (342)
      • conflict (371)
      • conflict (383)
      • conflict (413)
      • conflict (425)
  • Heterogens: CAA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lnqA (A:)
    hhhhhhssglvprgshmfrsslthlqaasrvfivgghitpfvgkgsplfidkkhpdfgkk
    knmtleeilattvqgtmehsglsgregivdqvvvgnflgelfssqghlgpaaigsltygq
    agsknplmykpamrvegaaasgglavisamnalksgsaditlavgvevqttasarvggdy
    laraadyqrqrqlddftfpclfakrmkyiaehnhftmedtarvaakayangnknplahmh
    trkltfeqcngedpsnvkflgnetykeylrmtdcsqvsdggagvvlaneeglrkmglspn
    dsrlveiksiacavsnlyedpddaccmftsrqaaqkalsmanikpsdlnvaevhdcftia
    emlmyealgiaeyghakdlirngdttlegripvntgggllsfghpvgatgikqimevyrq
    mkgqceayqmkkipalgatlnmggddktavsavlqni
    

    Sequence, based on observed residues (ATOM records):
    >5lnqA (A:)
    asrvfivgghitpfvgkgsplfidkkhpdfgkkknmtleeilattvqgtmehsglsgreg
    ivdqvvvgnflgelfssqghlgpaaigsltygqagsknplmykpamrvegaaasgglavi
    samnalksgsaditlavgvevqttasarvggdylaraadyqrqrqlddftfpclfakrmk
    yiaehnhftmedtarvaakayangnknplahmhtrkltfeqcngedpsnvkflgnetyke
    ylrmtdcsqvsdggagvvlaneeglrkmglspndsrlveiksiacavsnlyedpddaccm
    ftsrqaaqkalsmanikpsdlnvaevhdcftiaemlmyealgiaeyghakdlirngdttl
    egripvntgggllsfghpvgatgikqimevyrqmkgqceayqmkkipalgatlnmggddk
    tavsavlqni
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lnqB (B:)
    hhhhhhssglvprgshmfrsslthlqaasrvfivgghitpfvgkgsplfidkkhpdfgkk
    knmtleeilattvqgtmehsglsgregivdqvvvgnflgelfssqghlgpaaigsltygq
    agsknplmykpamrvegaaasgglavisamnalksgsaditlavgvevqttasarvggdy
    laraadyqrqrqlddftfpclfakrmkyiaehnhftmedtarvaakayangnknplahmh
    trkltfeqcngedpsnvkflgnetykeylrmtdcsqvsdggagvvlaneeglrkmglspn
    dsrlveiksiacavsnlyedpddaccmftsrqaaqkalsmanikpsdlnvaevhdcftia
    emlmyealgiaeyghakdlirngdttlegripvntgggllsfghpvgatgikqimevyrq
    mkgqceayqmkkipalgatlnmggddktavsavlqni
    

    Sequence, based on observed residues (ATOM records):
    >5lnqB (B:)
    asrvfivgghitpfvgkgsplfidkkhpdfgkkknmtleeilattvqgtmehsglsgreg
    ivdqvvvgnflgelfssqghlgpaaigsltygqagsknplmykpamrvegaaasgglavi
    samnalksgsaditlavgvevqttasarvggdylaraadyqrqrqlddftfpclfakrmk
    yiaehnhftmedtarvaakayangnknplahmhtrkltfeqcngedpsnvkflgnetyke
    ylrmtdcsqvsdggagvvlaneeglrkmglspndsrlveiksiacavsnlyedpddaccm
    ftsrqaaqkalsmanikpsdlnvaevhdcftiaemlmyealgiaeyghakdlirngdttl
    egripvntgggllsfghpvgatgikqimevyrqmkgqceayqmkkipalgatlnmggddk
    tavsavlqni
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lnqC (C:)
    hhhhhhssglvprgshmfrsslthlqaasrvfivgghitpfvgkgsplfidkkhpdfgkk
    knmtleeilattvqgtmehsglsgregivdqvvvgnflgelfssqghlgpaaigsltygq
    agsknplmykpamrvegaaasgglavisamnalksgsaditlavgvevqttasarvggdy
    laraadyqrqrqlddftfpclfakrmkyiaehnhftmedtarvaakayangnknplahmh
    trkltfeqcngedpsnvkflgnetykeylrmtdcsqvsdggagvvlaneeglrkmglspn
    dsrlveiksiacavsnlyedpddaccmftsrqaaqkalsmanikpsdlnvaevhdcftia
    emlmyealgiaeyghakdlirngdttlegripvntgggllsfghpvgatgikqimevyrq
    mkgqceayqmkkipalgatlnmggddktavsavlqni
    

    Sequence, based on observed residues (ATOM records):
    >5lnqC (C:)
    asrvfivgghitpfvgkgsplfidkkhpdfgkkknmtleeilattvqgtmehsglsgreg
    ivdqvvvgnflgelfssqghlgpaaigsltygqagsknplmykpamrvegaaasgglavi
    samnalksgsaditlavgvevqttasarvggdylaraadyqrqrqlddftfpclfakrmk
    yiaehnhftmedtarvaakayangnknplahmhtrkltfeqcngedpsnvkflgnetyke
    ylrmtdcsqvsdggagvvlaneeglrkmglspndsrlveiksiacavsnlyedpddaccm
    ftsrqaaqkalsmanikpsdlnvaevhdcftiaemlmyealgiaeyghakdlirngdttl
    egripvntgggllsfghpvgatgikqimevyrqmkgqceayqmkkipalgatlnmggddk
    tavsavlqni
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lnqD (D:)
    hhhhhhssglvprgshmfrsslthlqaasrvfivgghitpfvgkgsplfidkkhpdfgkk
    knmtleeilattvqgtmehsglsgregivdqvvvgnflgelfssqghlgpaaigsltygq
    agsknplmykpamrvegaaasgglavisamnalksgsaditlavgvevqttasarvggdy
    laraadyqrqrqlddftfpclfakrmkyiaehnhftmedtarvaakayangnknplahmh
    trkltfeqcngedpsnvkflgnetykeylrmtdcsqvsdggagvvlaneeglrkmglspn
    dsrlveiksiacavsnlyedpddaccmftsrqaaqkalsmanikpsdlnvaevhdcftia
    emlmyealgiaeyghakdlirngdttlegripvntgggllsfghpvgatgikqimevyrq
    mkgqceayqmkkipalgatlnmggddktavsavlqni
    

    Sequence, based on observed residues (ATOM records):
    >5lnqD (D:)
    asrvfivgghitpfvgkgsplfidkkhpdfgkkknmtleeilattvqgtmehsglsgreg
    ivdqvvvgnflgelfssqghlgpaaigsltygqagsknplmykpamrvegaaasgglavi
    samnalksgsaditlavgvevqttasarvggdylaraadyqrqrqlddftfpclfakrmk
    yiaehnhftmedtarvaakayangnknplahmhtrkltfeqcngedpsnvkflgnetyke
    ylrmtdcsqvsdggagvvlaneeglrkmglspndsrlveiksiacavsnlyedpddaccm
    ftsrqaaqkalsmanikpsdlnvaevhdcftiaemlmyealgiaeyghakdlirngdttl
    egripvntgggllsfghpvgatgikqimevyrqmkgqceayqmkkipalgatlnmggddk
    tavsavlqni