PDB entry 5lnn

View 5lnn on RCSB PDB site
Description: crystal structure of d1050a mutant of the receiver domain of the histidine kinase cki1 from arabidopsis thaliana
Deposited on 2016-08-05, released 2017-09-13
The last revision was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine kinase CKI1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CKI1, At2g47430, T30B22.27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22267
      • expression tag (10-15)
      • engineered mutation (125)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lnnA (A:)
    gsshhhhhhssglvprgshmastdsesetrvksvrtgrkpignpedeqetskpsddeflr
    gkrvlvvddnfisrkvatgklkkmgvseveqcdsgkealrlvtegltqreeqgsvdklpf
    dyifmacqmpemdgyeatreirkveksygvrtpiiavsghdpgseearetiqagmdafld
    kslnqlanvireieskrhlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lnnA (A:)
    sglvprsddeflrgkrvlvvddnfisrkvatgklkkmgvseveqcdsgkealrlvteglt
    qreeqgsvdklpfdyifmacqmpemdgyeatreirkveksygvrtpiiavsghdpgseea
    retiqagmdafldkslnqlanvireiesk