PDB entry 5lne

View 5lne on RCSB PDB site
Description: E. coli F9 pilus adhesin FmlH bound to the Thomsen-Friedenreich (TF) antigen
Class: cell adhesion
Keywords: fimbrial adhesin, lectin, O-glycan, cell adhesion
Deposited on 2016-08-04, released 2016-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Fml fimbrial adhesin FmlD
    Species: Escherichia coli [TaxId:562]
    Gene: fmlD, UTI89_C1716
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lnea_
  • Chain 'B':
    Compound: Putative Fml fimbrial adhesin FmlD
    Species: Escherichia coli [TaxId:562]
    Gene: fmlD, UTI89_C1716
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RBS0 (0-157)
      • expression tag (158-163)
    Domains in SCOPe 2.08: d5lneb1, d5lneb2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lneA (A:)
    fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
    safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
    ageviarihmykiatlgsgnprnftwniisnnsvvmpthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lneA (A:)
    fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
    safaglqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgvvikagevi
    arihmykiatlgsgnprnftwniisnnsvvmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lneB (B:)
    fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
    safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
    ageviarihmykiatlgsgnprnftwniisnnsvvmpthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lneB (B:)
    fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
    safaslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaggvvikag
    eviarihmykiatlgsgnprnftwniisnnsvvmpthhhhhh