PDB entry 5lnc

View 5lnc on RCSB PDB site
Description: structure of spx domain of the yeast inorganic polyphophate polymerase vtc4 crystallized by carrier-driven crystallization in fusion with the macro domain of human histone macroh2a1.1
Deposited on 2016-08-03, released 2016-11-09
The last revision was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 3.29 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar transporter chaperone 4,Core histone macro-H2A.1
    Species: Homo sapiens [TaxId:9606]
    Gene: H2AFY, MACROH2A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47075 (Start-177)
      • linker (178)
    • Uniprot O75367 (Start-366)
      • expression tag (367-370)
  • Chain 'B':
    Compound: Vacuolar transporter chaperone 4,Core histone macro-H2A.1
    Species: Homo sapiens [TaxId:9606]
    Gene: H2AFY, MACROH2A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47075 (Start-177)
      • linker (178-181)
    • Uniprot O75367 (182-366)
      • expression tag (367-368)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lncA (A:)
    mkfgehlskslirqysyyyisyddlktelednlsknngqwtqeletdflesleieldkvy
    tfckvkhsevfrrvkevqeqvqhtvrlldsnnpptqldfeileeelsdiiadvhdlakfs
    rlnytgfqkiikkhdkktgfilkpvfqvrldskpffkenydelvvkisqlydiartsgag
    sdgftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefv
    eavlelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclalad
    dkklksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiy
    vqemaklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lncA (A:)
    kfgehlskslirqysyyyisyddlktelednlsknngtqeletdflesleieldkvytfc
    kvkhsevfrrvkevqeqvqhtvrlldsnnpptqldfeileeelsdiiadvhdlakfsrln
    ytgfqkiikkhdkktgfilkpvfqvrldskpffkenydelvvkisqlydiartsgaftvl
    stkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefveavlelr
    kkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdkklksi
    afpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvqemakl
    ehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lncB (B:)
    mkfgehlskslirqysyyyisyddlktelednlsknngqwtqeletdflesleieldkvy
    tfckvkhsevfrrvkevqeqvqhtvrlldsnnpptqldfeileeelsdiiadvhdlakfs
    rlnytgfqkiikkhdkktgfilkpvfqvrldskpffkenydelvvkisqlydiartsgag
    sdgftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefv
    eavlelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclalad
    dkklksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiy
    vqemaklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lncB (B:)
    fgehlskslirqysyyyisyddlktelednlsknngqwtqeletdflesleieldkvytf
    ckvkhsevfrrvkevqeqvqhtvrlldsnnpptqldfeileeelsdiiadvhdlakfsrl
    nytgfqkiikkhdkktgfilkpvfqvrldskpffkenydelvvkisqlydiartsgagsd
    gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefvea
    vlelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdk
    klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq
    emakleh