PDB entry 5ln4

View 5ln4 on RCSB PDB site
Description: crystal structure of self-complemented psaa, the major subunit of ph 6 antigen from yersinia pests, in complex with choline
Deposited on 2016-08-03, released 2016-08-24
The last revision was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pH 6 antigen,pH 6 antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: psaA, YPO1303, y2882, YP_1289
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31522 (0-112)
      • linker (113-116)
    • Uniprot P31522 (117-132)
  • Chain 'B':
    Compound: pH 6 antigen,pH 6 antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: psaA, YPO1303, y2882, YP_1289
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31522 (0-112)
      • linker (113-116)
    • Uniprot P31522 (117-132)
  • Chain 'C':
    Compound: pH 6 antigen,pH 6 antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: psaA, YPO1303, y2882, YP_1289
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31522 (0-112)
      • linker (113-116)
    • Uniprot P31522 (117-132)
  • Heterogens: CHT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5ln4A (A:)
    tfhvdfapntgeifagkqpgdvtmftltmgdtaphggwrliptgdskggymisadgdyvg
    lysymmswvgidnnwyinddspkdikdhlyvkagtvlkpttykftgrveeyvfndkqstv
    inskdvsgevtvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5ln4B (B:)
    tfhvdfapntgeifagkqpgdvtmftltmgdtaphggwrliptgdskggymisadgdyvg
    lysymmswvgidnnwyinddspkdikdhlyvkagtvlkpttykftgrveeyvfndkqstv
    inskdvsgevtvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5ln4C (C:)
    tfhvdfapntgeifagkqpgdvtmftltmgdtaphggwrliptgdskggymisadgdyvg
    lysymmswvgidnnwyinddspkdikdhlyvkagtvlkpttykftgrveeyvfndkqstv
    inskdvsgevtvk