PDB entry 5lmz

View 5lmz on RCSB PDB site
Description: Fluorinase from Streptomyces sp. MA37
Class: transferase
Keywords: Fluorinase, transferase
Deposited on 2016-08-02, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorinase
    Species: Streptomyces sp. MA37 [TaxId:1400207]
    Gene: flA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lmza1, d5lmza2
  • Chain 'B':
    Compound: Fluorinase
    Species: Streptomyces sp. MA37 [TaxId:1400207]
    Gene: flA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lmzb1, d5lmzb2
  • Heterogens: 1DA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lmzA (A:)
    gamvaangsqrpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegar
    yivdlprffpegtvfatttypatgtttrsvavrirqaakggargqwagsgdgferadgsy
    iyiapnngllttvleehgyieayevtstkvipanpeptfysremvaipsahlaagfplae
    vgrrlddseivrfhrpaveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlk
    iilddvlpfeapltptfadagaigniafylnsrgylslarnaaslaypynlkaglkvrve
    ar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmzA (A:)
    rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrirqaaqwagsgdgferadgsyiyiapnngllttvlee
    hgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddseivrfhrp
    avealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltptfada
    gaigniafylnsrgylslarnaaslaypynlkaglkvrvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lmzB (B:)
    gamvaangsqrpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegar
    yivdlprffpegtvfatttypatgtttrsvavrirqaakggargqwagsgdgferadgsy
    iyiapnngllttvleehgyieayevtstkvipanpeptfysremvaipsahlaagfplae
    vgrrlddseivrfhrpaveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlk
    iilddvlpfeapltptfadagaigniafylnsrgylslarnaaslaypynlkaglkvrve
    ar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmzB (B:)
    rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrirqaaqwagsgdgferadgsyiyiapnngllttvlee
    hgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddseivrfhrp
    aveialsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltptfad
    agaigniafylnsrgylslarnaaslaypynlkaglkvrvea