PDB entry 5lmg

View 5lmg on RCSB PDB site
Description: structure of c-terminal domain from s. cerevisiae pat1 decapping activator bound to dcp2 hlm10 peptide (region 954-970)
Deposited on 2016-07-30, released 2017-08-16
The last revision was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase 2-associated protein pat1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAT1, MRT1, YCR077C, YCR77C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25644 (Start-368)
      • engineered mutation (278)
      • engineered mutation (285)
  • Chain 'B':
    Compound: DNA topoisomerase 2-associated protein pat1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAT1, MRT1, YCR077C, YCR77C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25644 (Start-368)
      • engineered mutation (278)
      • engineered mutation (285)
  • Chain 'C':
    Compound: mRNA decapping protein 2
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: mRNA decapping protein 2
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, MG, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lmgA (A:)
    mhhhhhhssgssstgssaaavaskqrrrssyafnngngatnlnksggkkfilelietvye
    eildleanlrngqqtdstamwealhiddssydvnpfismlsfdkgikimprifnfldkqq
    klkilqkifnelshlqiiilssykttpkptltqlkkvdlfqmiilkiivsflsnnsnfie
    imglllqlirnnnvsflttskiglnlitilisraalikqdssrsnilsspeistwneiyd
    klftsleskiqlifppreyndhimrlqndkfmdeayiwaflaslaasgklnhqriiidev
    rdeifatineaetlqkkekelsvlpqrsqeldtelksiiynkeklyqdlnlflnvmglvy
    rdgeiselk
    

    Sequence, based on observed residues (ATOM records):
    >5lmgA (A:)
    nlnksggkkfilelietvyeeildleanlrngqqtdstamwealhiddssydvnpfisml
    sfdkgikimprifnfldkqqklkilqkifnelshlqiiilssykttpkptltqlkkvdlf
    qmiilkiivsflsnnsnfieimglllqlirnnnvsflttskiglnlitilisraalikis
    twneiydklftsleskiqlifppreyndhimrlqndkfmdeayiwaflaslaasgklnhq
    riiidevrdeifatineaetlqkkekelsvlpqrsqeldtelksiiynkeklyqdlnlfl
    nvmglvyrdgeiselk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lmgB (B:)
    mhhhhhhssgssstgssaaavaskqrrrssyafnngngatnlnksggkkfilelietvye
    eildleanlrngqqtdstamwealhiddssydvnpfismlsfdkgikimprifnfldkqq
    klkilqkifnelshlqiiilssykttpkptltqlkkvdlfqmiilkiivsflsnnsnfie
    imglllqlirnnnvsflttskiglnlitilisraalikqdssrsnilsspeistwneiyd
    klftsleskiqlifppreyndhimrlqndkfmdeayiwaflaslaasgklnhqriiidev
    rdeifatineaetlqkkekelsvlpqrsqeldtelksiiynkeklyqdlnlflnvmglvy
    rdgeiselk
    

    Sequence, based on observed residues (ATOM records):
    >5lmgB (B:)
    ggkkfilelietvyeeildleanlrngqqtdstamwealhiddssnpfismlsfdkgiki
    mprifnfldkqqklkilqkifnelshlqiiilssykttpkptltqlkkvdlfqmiilkii
    vsflsnnsnfieimglllqlirnnnvsflttskiglnlitilisraalikqdssrsnils
    speistwneiydklftsleskiqlifppreyndhimrlqndkfmdeayiwaflaslaasg
    klnhqriiidevrdeifatineaetlqkkekelsvlpqrsqeldtelksiiynkeklyqd
    lnlflnvmglvyrdgeiselk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lmgC (C:)
    tsgsnellsilhrk
    

    Sequence, based on observed residues (ATOM records):
    >5lmgC (C:)
    tsgsnellsilhr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lmgD (D:)
    tsgsnellsilhrk
    

    Sequence, based on observed residues (ATOM records):
    >5lmgD (D:)
    sgsnellsilhrk