PDB entry 5lm3

View 5lm3 on RCSB PDB site
Description: Plasmodium falciparum nicotinic acid mononucleotide adenylyltransferase complexed with APC
Class: transferase
Keywords: Nicotinic acid mononucleotide adenylyltransferase, NaMNAT, protein crystallography, Plasmodium falciparum, drug target, malaria, NAD metabolism, transferase
Deposited on 2016-07-29, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_1327600
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IE38 (2-204)
      • expression tag (205-206)
    Domains in SCOPe 2.07: d5lm3a1, d5lm3a2
  • Heterogens: APC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lm3A (A:)
    mghkniciyggsfdpityahemvldkisnlnwiheiwvvicrcrndksltefhhrhnmft
    iiinnsskiikskiflkdleshsemtptydllktqkelhpnytfyfglgsdlicdifswd
    egeklvlenafiiierghfkidesilkkfpkyylinipklsfinfisssearkfltkend
    indikkyihpltidyiikynlydfnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lm3A (A:)
    hkniciyggsfdpityahemvldkisnlnwiheiwvvicrcsltefhhrhnmftiiinns
    skiikskiflkdleshsemtptydllktqkelhpnytfyfglgsdlicdifswdegeklv
    lenafiiierghfkidesilkkfpkyylinipklsfinfisssearkfltkendindikk
    yihpltidyiikynlydfnle