PDB entry 5llw

View 5llw on RCSB PDB site
Description: bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l
Deposited on 2016-07-28, released 2017-03-15
The last revision was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diguanylate cyclase (GGDEF) domain-containing protein
    Species: Idiomarina sp. A28L [TaxId:1036674]
    Gene: A28LD_0430
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Diguanylate cyclase (GGDEF) domain-containing protein
    Species: Idiomarina sp. A28L [TaxId:1036674]
    Gene: A28LD_0430
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LBV, CL

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5llwA (A:)
    gamaadlgsddiskliaacdqepihipnaiqpfgamlivekdtqqivyasansaeyfsva
    dntihelsdikqaninsllpehlisglasairenepiwvetdrlsflgwrhenyyiieve
    ryhvqtsnwfeiqfqrafqklrnckthndlintltrliqeisgydrvmiyqfdpewngrv
    iaesvrqlftsmlnhhfpasdipaqaramysinpiriipdvnaepqplhmihkpqnteav
    nlssgvlravsplhmqylrnfgvsastsigifnedelwgivachhtkpraigrrirrllv
    rtvefaaerlwlihsrnverymvtvqaareqlsttaddkhssheiviehaadwcklfrcd
    gigylrgeelttygetpdqttinklvewleengkkslfwhshmlkedapgllpdgsrfag
    llaiplksdadlfsylllfrvaqnevrtwagkpeklsvetstgtmlgprksfeawqdevs
    gksqpwrtaqlyaardiardllivadsmqlnllndqladanenleklasfddltgifnrr
    rmedrlesevkeaqrykkqfgillfdldkfksvndtyghnigdqilqntcaavsetlrdt
    dkfgrwggeefliiapqtgmpelmqlgervraavekmqhkdlpavtisigvaefqndtrw
    dhmidradkamyrakengrnqvcsq
    

    Sequence, based on observed residues (ATOM records):
    >5llwA (A:)
    ddiskliaacdqepihipnaiqpfgamlivekdtqqivyasansaeyfsvadntihelsd
    ikqaninsllpehlisglasairenepiwvetdrlsflgwrhenyyiieveryhvqtsnw
    feiqfqrafqklrnckthndlintltrliqeisgydrvmiyqfdpewngrviaesvrqlf
    tsmlnhhfpasdipaqaramysinpiriipdvnaepqplhmihkpqnteavnlssgvlra
    vsplhmqylrnfgvsastsigifnedelwgivachhtkpraigrrirrllvrtvefaaer
    lwlihsrnverymvtvqaareqlsttaddkhssheiviehaadwcklfrcdgigylrgee
    lttygetpdqttinklvewleengkkslfwhshmlkedapgllpdgsrfagllaiplklf
    sylllfrvaqnevrtwagkpeklsvetstgtmlgprksfeawqdevsgksqpwrtaqlya
    ardiardllivadsmqlnllndqladanenleklasfddltgifnrrrmedrlesevkea
    qrykkqfgillfdldkfksvndtyghnigdqilqntcaavsetlrdtdkfgrwggeefli
    iapqtgmpelmqlgervraavekmqhkdlpavtisigvaefqndtrwdhmidradkamyr
    akengrnqvcsq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5llwB (B:)
    gamaadlgsddiskliaacdqepihipnaiqpfgamlivekdtqqivyasansaeyfsva
    dntihelsdikqaninsllpehlisglasairenepiwvetdrlsflgwrhenyyiieve
    ryhvqtsnwfeiqfqrafqklrnckthndlintltrliqeisgydrvmiyqfdpewngrv
    iaesvrqlftsmlnhhfpasdipaqaramysinpiriipdvnaepqplhmihkpqnteav
    nlssgvlravsplhmqylrnfgvsastsigifnedelwgivachhtkpraigrrirrllv
    rtvefaaerlwlihsrnverymvtvqaareqlsttaddkhssheiviehaadwcklfrcd
    gigylrgeelttygetpdqttinklvewleengkkslfwhshmlkedapgllpdgsrfag
    llaiplksdadlfsylllfrvaqnevrtwagkpeklsvetstgtmlgprksfeawqdevs
    gksqpwrtaqlyaardiardllivadsmqlnllndqladanenleklasfddltgifnrr
    rmedrlesevkeaqrykkqfgillfdldkfksvndtyghnigdqilqntcaavsetlrdt
    dkfgrwggeefliiapqtgmpelmqlgervraavekmqhkdlpavtisigvaefqndtrw
    dhmidradkamyrakengrnqvcsq
    

    Sequence, based on observed residues (ATOM records):
    >5llwB (B:)
    ddiskliaacdqepihipnaiqpfgamlivekdtqqivyasansaeyfsvadntihelsd
    ikqaninsllpehlisglasairenepiwvetdrlsflgwrhenyyiieveryhvqtsnw
    feiqfqrafqklrnckthndlintltrliqeisgydrvmiyqfdpewngrviaesvrqlf
    tsmlnhhfpasdipaqaramysinpiriipdvnaepqplhmihkpqnteavnlssgvlra
    vsplhmqylrnfgvsastsigifnedelwgivachhtkpraigrrirrllvrtvefaaer
    lwlihsrnverymvtvqaareqlsttaddkhssheiviehaadwcklfrcdgigylrgee
    lttygetpdqttinklvewleengkkslfwhshmlkedapgllpdgsrfagllaiplksl
    fsylllfrvaqnevrtwagkpeklsvetstgtmlgprksfeawqdevsgksqpwrtaqly
    aardiardllivadsmqlnllndqladanenleklasfddltgifnrrrmedrlesevke
    aqrykkqfgillfdldkfksvndtyghnigdqilqntcaavsetlrdtdkfgrwggeefl
    iiapqtgmpelmqlgervraavekmqhkdlpavtisigvaefqndtrwdhmidradkamy
    rakengrnqvcsq