PDB entry 5llu

View 5llu on RCSB PDB site
Description: structure of the thermostabilized eaat1 cryst-ii mutant in complex with l-asp
Deposited on 2016-07-28, released 2017-04-19
The last revision was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 3.32 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Excitatory amino acid transporter 1,Neutral amino acid transporter B(0),Excitatory amino acid transporter 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SLC1A3, EAAT1, GLAST, GLAST1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43003
      • conflict (43)
      • conflict (45)
      • conflict (49-50)
      • conflict (55)
      • conflict (59)
      • conflict (61-62)
      • conflict (66)
      • conflict (71-72)
      • conflict (74)
      • conflict (81)
      • conflict (92)
      • conflict (95)
      • conflict (100)
      • conflict (104)
      • conflict (107)
      • conflict (109)
      • conflict (112)
      • conflict (117-118)
      • conflict (128)
      • conflict (136)
      • conflict (140)
      • conflict (142)
    • Uniprot Q15758 (Start-221)
      • conflict (174)
    • Uniprot P43003 (222-End)
      • conflict (222)
      • conflict (230-231)
      • conflict (234-236)
      • conflict (238)
      • conflict (240)
      • conflict (245)
      • conflict (247-248)
      • conflict (251)
      • conflict (257)
      • conflict (259)
      • conflict (263)
      • conflict (270)
      • conflict (294)
      • conflict (297)
      • conflict (305)
      • conflict (308-309)
      • conflict (315)
      • conflict (319)
      • conflict (325)
      • conflict (329)
      • conflict (331)
      • conflict (365)
      • conflict (387)
      • conflict (436)
      • conflict (453)
      • conflict (457)
      • conflict (460-461)
      • conflict (467)
      • conflict (479)
      • conflict (482-484)
      • conflict (486)
      • conflict (488)
  • Heterogens: NA, ASP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lluA (A:)
    mtksngeepkmggrmerfqqgvskrtllakkkvqnitkedvksflrrnalllltvlavil
    gvvlgfllrpyplsprevkyfafpgellmrmlkmlilplivsslitglasldakasgrlg
    mravvyymsttiiavvlgiilvliihpgaasaaitasvgaagsaenapskevldcfldla
    rnifpsnlvsaafrsysttyeertitgtrvkvpvgqevegmnilglvvfsivfgialgkm
    geqgqllvdffnslneatmklvaiimwyaplgilfliagkivemedlevlggqlgmymvt
    vivglvihglivlpliyflitrknpfvfiagilqalitalgtssssatlpitfkcleenn
    gvdkritrfvlpvgatinmdgtalyeavaaifiaqvnnyeldfgqiitisitataasiga
    agipqaglvtmvivltavglptdditliiavdwlldrfrtmvnvlgdalgagivehlsrk
    elekqdaelgnsvieenemkkpyqliaqdnetekpidsetkm
    

    Sequence, based on observed residues (ATOM records):
    >5lluA (A:)
    edvksflrrnalllltvlavilgvvlgfllrpyplsprevkyfafpgellmrmlkmlilp
    livsslitglasldakasgrlgmravvyymsttiiavvlgiilvliievldcfldlarni
    fpsnlvsaafrsysttqevegmnilglvvfsivfgialgkmgeqgqllvdffnslneatm
    klvaiimwyaplgilfliagkivelgmymvtvivglvihglivlpliyflitrknpfvfi
    agilqalitalgtssssatlpitfkcleenngvdkritrfvlpvgatinmdgtalyeava
    aifiaqvnngqiitisitataasigaagipqaglvtmvivltavglptdditliiavdwl
    ldrfrtmvnvlgdalgagivehlsrkelekqdaelg