PDB entry 5llq

View 5llq on RCSB PDB site
Description: crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Deposited on 2016-07-28, released 2016-11-09
The last revision was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylated-DNA--protein-cysteine methyltransferase
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: ogt, SSO2487
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VW7 (13-163)
      • engineered mutation (131)
  • Chain 'B':
    Compound: methylated-DNA--protein-cysteine methyltransferase
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: ogt, SSO2487
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VW7 (13-End)
      • engineered mutation (131)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5llqA (A:)
    mrgshhhhhhtdpmlvyglyksplgyitvakddkgfimldfcdcvegnsrddssfteffh
    kldlyfegkpinlrepinlktypfrlsvfkevmkipwgkvmtykqiadslgtspravgma
    lsknpilliipfhrviaengiggysrgvklkrallelegvkipe
    

    Sequence, based on observed residues (ATOM records):
    >5llqA (A:)
    mlvyglyksplgyitvakddkgfimldfcdcvegnsrddssfteffhkldlyfegkpinl
    repinlktypfrlsvfkevmkipwgkvmtykqiadslgtspravgmalsknpilliipfh
    rviaengiggysrgvklkrallelegvkipe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5llqB (B:)
    mrgshhhhhhtdpmlvyglyksplgyitvakddkgfimldfcdcvegnsrddssfteffh
    kldlyfegkpinlrepinlktypfrlsvfkevmkipwgkvmtykqiadslgtspravgma
    lsknpilliipfhrviaengiggysrgvklkrallelegvkipe
    

    Sequence, based on observed residues (ATOM records):
    >5llqB (B:)
    mlvyglyksplgyitvakddkgfimldfcdcvegnsrddssfteffhkldlyfegkpinl
    repinlktypfrlsvfkevmkipwgkvmtykqiadslgtspravgmalsknpilliipfh
    rviaengiggysrgvklkrallelegvk