PDB entry 5lll

View 5lll on RCSB PDB site
Description: Crystal structure of DACM wild type Transthyretin
Class: transport protein
Keywords: Tetramer, Protein aggregation, N-(7-Dimethylamino-4-Methylcoumarin-3-yl))Maleimide, transport protein
Deposited on 2016-07-27, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5llla_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lllb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lllA (A:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lllA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lllB (B:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lllB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn