PDB entry 5llf

View 5llf on RCSB PDB site
Description: structure of polyphosphate kinase 2 mutant d117n from francisella tularensis with polyphosphate
Deposited on 2016-07-27, released 2017-10-11
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyphosphate kinase 2
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: ppk2, FTT_1564, BZ14_1190
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NEQ5
      • engineered mutation (116)
  • Chain 'B':
    Compound: Polyphosphate kinase 2
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: ppk2, FTT_1564, BZ14_1190
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NEQ5
      • engineered mutation (116)
  • Chain 'C':
    Compound: Polyphosphate kinase 2
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: ppk2, FTT_1564, BZ14_1190
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NEQ5
      • engineered mutation (116)
  • Chain 'D':
    Compound: Polyphosphate kinase 2
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: ppk2, FTT_1564, BZ14_1190
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NEQ5 (Start-268)
      • engineered mutation (116)
  • Heterogens: PO4, 6YX, 6YY, CL, 6YW, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5llfA (A:)
    mkvlsqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifeg
    rdaagkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrsw
    ynragvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaares
    hplkqwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyil
    nnvdydnkdhevaippdplivgtsskiyk
    

    Sequence, based on observed residues (ATOM records):
    >5llfA (A:)
    sqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifegrdaa
    gkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrswynra
    gvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaareshplk
    qwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyilnnvd
    ydnkdhevaippdplivgtsskiy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5llfB (B:)
    mkvlsqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifeg
    rdaagkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrsw
    ynragvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaares
    hplkqwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyil
    nnvdydnkdhevaippdplivgtsskiyk
    

    Sequence, based on observed residues (ATOM records):
    >5llfB (B:)
    sqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifegrdaa
    gkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrswynra
    gvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaareshplk
    qwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyilnnvd
    ydnkdhevaippdplivgtsskiy
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5llfC (C:)
    mkvlsqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifeg
    rdaagkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrsw
    ynragvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaares
    hplkqwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyil
    nnvdydnkdhevaippdplivgtsskiyk
    

    Sequence, based on observed residues (ATOM records):
    >5llfC (C:)
    sqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifegrdaa
    gkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrswynra
    gvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaareshplk
    qwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyilnnvd
    ydnkdhevaippdplivgtsskiy
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5llfD (D:)
    mkvlsqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifeg
    rdaagkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrsw
    ynragvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaares
    hplkqwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyil
    nnvdydnkdhevaippdplivgtsskiyk
    

    Sequence, based on observed residues (ATOM records):
    >5llfD (D:)
    lsqeerqklflenifpykhkiprnvyekqkhylqiellkfqkwvkennkkvliifegrda
    agkggtikrmmehlnprgakvialekpseqernqwyfqryiehlpsggeivlfnrswynr
    agvervmgfctereyflfleqapqlekmlvdsgtmiikfwfsvsqqeqknrfaareshpl
    kqwklspidkasldkwddyteakermfiytdkpyapwvivksddkkrarlnairyilnnv
    dydnkdhevaippdplivgtsskiyk