PDB entry 5ll7

View 5ll7 on RCSB PDB site
Description: crystal structure of kpc-2 carbapenemase in complex with a phenyl boronic inhibitor.
Deposited on 2016-07-26, released 2018-02-21
The last revision was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaKPC-18
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 6YV, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ll7A (A:)
    tnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsqq
    qaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpa
    gltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqq
    fvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytra
    pnkddkhseaviaaaarlaleglgvngq
    

    Sequence, based on observed residues (ATOM records):
    >5ll7A (A:)
    tnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsqq
    qaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpa
    gltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqq
    fvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytra
    pnkddkhseaviaaaarlaleglg