PDB entry 5lkx

View 5lkx on RCSB PDB site
Description: crystal structure of the p300 acetyltransferase catalytic core with propionyl-coenzyme a.
Deposited on 2016-07-25, released 2016-11-02
The last revision was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300,Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (Start-486)
      • engineered mutation (434)
      • linker (487-491)
    • Uniprot Q09472 (492-End)
  • Heterogens: ZN, 1VU, DMS, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lkxA (A:)
    gamagkavpmqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdi
    vkspmdlstikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqe
    idpvmqslgyccgrklefspqtlccygkqlctiprdatyysyqnryhfcekcfneiqges
    vslgddpsqpqttinkeqfskrkndtldpelfvectecgrkmhqicvlhheiiwpagfvc
    dgclkksartrkenkfsakrlpstrlgtflenrvndflrrqnhpesgevtvrvvhasdkt
    vevkpgmkarfvdsgemaesfpyrtkalfafeeidgvdlcffgmhvqeygsdcpppnqrr
    vyisyldsvhffrpkclrtavyheiligyleyvkklgyttghiwacppsegddyifhchp
    pdqkipkpkrlqewfkkmldkavserivhdykdifkqatedrltsakelpyfegdfwpnv
    leesikesggsgsqklyatmekhkevffvirliagpaanslppivdpdplipcdlmdgrd
    afltlardkhlefsslrraqwstmcmlvelhtqsqdrf
    

    Sequence, based on observed residues (ATOM records):
    >5lkxA (A:)
    kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrk
    ldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslgyccg
    rklefspqtlccygkqlctiprdatyysyqnryhfcekcfneiqgesvslgqttinkeqf
    skrkndtldpelfvectecgrkmhqicvlhheiiwpagfvcdgclkksartrkenkfsak
    rlpstrlgtflenrvndflrrqnhpesgevtvrvvhasdktvevkpgmkarfvdsgemae
    sfpyrtkalfafeeidgvdlcffgmhvqeygsdcpppnqrrvyisyldsvhffrpkclrt
    avyheiligyleyvkklgyttghiwacppsegddyifhchppdqkipkpkrlqewfkkml
    dkavserivhdykdifkqatedrltsakelpyfegdfwpnvleesikesggsgsqklyat
    mekhkevffvirliagpaanslppivdpdplipcdlmdgrdafltlardkhlefsslrra
    qwstmcmlvelhtq