PDB entry 5lkq

View 5lkq on RCSB PDB site
Description: protease domain of rada
Deposited on 2016-07-22, released 2017-06-07
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein RadA
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA repair protein RadA
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0T7K9X0 (Start-197)
      • conflict (21)
      • conflict (177)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lkqA (A:)
    maswshpqfeksggggglvprgsqvfleerldgatgssivvtmegtrpilaevqalvtpt
    mfgnakrtttgldfnraslimavlekraglllqnqdaylksaggvkldepaidlavavai
    assykdkptnpqecfvgelgltgeirrvnrieqrineaaklgftkiyvpknsltgitlpk
    eiqvigvttiqevlkkvf
    

    Sequence, based on observed residues (ATOM records):
    >5lkqA (A:)
    sqvfleerldgatgssivvtmegtrpilaevqalvtptmfgnakrtttgldfnraslima
    vlekraglllqnqdaylksaggvkldepaidlavavaiassykdkptnpqecfvgelglt
    geirrvnrieqrineaaklgftkiyvpknsltgitlpkeiqvigvttiqevlkkvf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lkqB (B:)
    maswshpqfeksggggglvprgsqvfleerldgatgssivvtmegtrpilaevqalvtpt
    mfgnakrtttgldfnraslimavlekraglllqnqdaylksaggvkldepaidlavavai
    assykdkptnpqecfvgelgltgeirrvnrieqrineaaklgftkiyvpknsltgitlpk
    eiqvigvttiqevlkkvf
    

    Sequence, based on observed residues (ATOM records):
    >5lkqB (B:)
    gsqvfleerldgatgssivvtmegtrpilaevqalvtptmfgnakrtttgldfnraslim
    avlekraglllqnqdaylksaggvkldepaidlavavaiassykdkptnpqecfvgelgl
    tgeirrvnrieqrineaaklgftkiyvpknsltgitlpkeiqvigvttiqevlkkvf