PDB entry 5lkl

View 5lkl on RCSB PDB site
Description: crystal structure of full-lengh csfv ns3/4a
Deposited on 2016-07-22, released 2017-01-25
Made obsolete by 5mz4 on 2017-02-15

The last revision was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Classical swine fever virus (strain Alfort) [TaxId:11097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19712 (Start-747)
      • expression tag (17-45)
      • conflict (54-57)
      • conflict (571)
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Classical swine fever virus (strain Alfort) [TaxId:11097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19712 (Start-747)
      • expression tag (12-45)
      • conflict (54-57)
      • conflict (379)
      • conflict (381)
      • conflict (439)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lklA (A:)
    mashhhhhhhenlyfqgskrhipvvtdiysvedhrledtthlqyapnaiktegkgsgsgp
    avckkvtehercttsimdkltaffgvmprgttprapvrfptsllkirrgletgwaythqg
    gissvdhvtcgkdllvcdtmgrtrvvcqsnnkmtdeseygvktdsgcpegarcyvfnpea
    vnisgtkgamvhlqktggeftcvtasgtpaffdlknlkgwsglpifeassgrvvgrvkvg
    knedskptklmsgiqtvskatdltemvkkittmnrgefrqitlatgagkttelprsviee
    igrhkrvlvliplraaaesvyqymrqkhpsiafnlrigemkegdmatgityasygyfcqm
    sqpklraamveysfifldeyhcatpeqlaimgkihrfsenlrvvamtatpagtvtttgqk
    hpieefiapevmkgedlgseyldiaglkipveemknnmlvfvptrnmaveaakklkakgy
    nsgyyysgedpsnlrvvtsqspyvvvatnaiesgvtlpdldvvvdtglkcekrirlspkm
    pfivtglkrmavtigeqaqrrgrvgrvkpgrfyrsqetpvgskdyhydllqaqrygiedg
    initksfremnydwslyeedslmitqleilnnlliseelpmavknimartdhpepiqlay
    nsyetqvpvlfpkirngevtdtydnytflnarklgddvppyvyatededlavellgldwp
    dpgnqgtveagralkqvvglstaenall
    

    Sequence, based on observed residues (ATOM records):
    >5lklA (A:)
    skrhipvvtdiysvedhrledtthlqyapgsgsgpavckkvtehercttsimdkltaffg
    vmprgttprapvrfptsllkirrgletgwaythqggissvdhvtcgkdllvcdtmgrtrv
    vcqsnnkmtdeseygvktdsgcpegarcyvfnpeavnisgtkgamvhlqktggeftcvta
    sgtpaffdlknlkgwsglpifeassgrvvgrvkvgknedskptklmsgatdltemvkkit
    tmnrgefrqitlatgagkttelprsvieeigrhkrvlvliplraaaesvyqymrqkhpsi
    afnlrigemkegdmatgityasygyfcqmsqpklraamveysfifldeyhcatpeqlaim
    gkihrfsenlrvvamtatpagtvthpieefiapeveyldiaglkipveemknnmlvfvpt
    rnmaveaakklkakgynsgyyysgedpsnlrvvtsqspyvvvatnaiesgvtlpdldvvv
    dtglkcekrirlspkmpfivtglkrmavtigeqaqrrgrvgrvkpgrfyrsqetpvgskd
    yhydllqaqrygiedginitksfremnydwslyeedslmitqleilnnlliseelpmavk
    nimartdhpepiqlaynsyetqvpvlfpkirngevtdtydnytflnarklgddvppyvya
    tededlavellgldwpdpgnqgtveagralkqvvglstaenall
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lklB (B:)
    mashhhhhhhenlyfqgskrhipvvtdiysvedhrledtthlqyapnaiktegkgsgsgp
    avckkvtehercttsimdkltaffgvmprgttprapvrfptsllkirrgletgwaythqg
    gissvdhvtcgkdllvcdtmgrtrvvcqsnnkmtdeseygvktdsgcpegarcyvfnpea
    vnisgtkgamvhlqktggeftcvtasgtpaffdlknlkgwsglpifeassgrvvgrvkvg
    knedskptklmsgiqtvskatdltemvkkittmnrgefrqitlatgagkttelprsviee
    igrhkrvlvliplraaaesvyqymrqkhpsiafnlrigemkegdmatgityasygyfcqm
    sqpklraamveysfifldefhmatpeqlaimgkihrfsenlrvvamtatpagtvtttgqk
    hpieefiapevmkgedlgsdyldiaglkipveemknnmlvfvptrnmaveaakklkakgy
    nsgyyysgedpsnlrvvtsqspyvvvatnaiesgvtlpdldvvvdtglkcekrirlspkm
    pfivtglkrmavtigeqaqrrgrvgrvkpgryyrsqetpvgskdyhydllqaqrygiedg
    initksfremnydwslyeedslmitqleilnnlliseelpmavknimartdhpepiqlay
    nsyetqvpvlfpkirngevtdtydnytflnarklgddvppyvyatededlavellgldwp
    dpgnqgtveagralkqvvglstaenall
    

    Sequence, based on observed residues (ATOM records):
    >5lklB (B:)
    lyfqgskrhipvvtdiysvedhrledtthlqyapgsgsgpavckkvtehercttsimdkl
    taffgvmprgttprapvrfptsllkirrgletgwaythqggissvdhvtcgkdllvcdtm
    grtrvvcqsnnkmtdeseygvktdsgcpegarcyvfnpeavnisgtkgamvhlqktggef
    tcvtasgtpaffdlknlkgwsglpifeassgrvvgrvkvgknedskptklmsgiqltemv
    kkittmnrgefrqitlatgagkttelprsvieeigrhkrvlvliplraaaesvyqymrqk
    hpsiafnlrigemkegdmatgityasygyfcqmsqpklraamveysfifldefhmatpeq
    laimgkihrfsenlrvvamtaieefiapevmkggsdyldiaglkipveemknnmlvfvpt
    rnmaveaakklkakgynsgyyysgedpsnlrvvvatnaievvdtglkcekrirlspkmpf
    ivtglkrmavtigeqaqrrgrvyyrsqetpvgskdyhydllqaqrygiedginitksfre
    mnydwslyeedslmitqleilnnlliseelpmavknimartdhpepiqlaynsyetqvpv
    lfpkirngevtdtydnytflnarklgddvppyvyatededlavellgldwpdpgnqgtve
    agralkqvvglstaenall