PDB entry 5lke

View 5lke on RCSB PDB site
Description: Bovine beta-lactoglobulin complex with myristic acid, ambient pressure
Class: transport protein
Keywords: beta-lactoglobulin, lipocalin, transport protein
Deposited on 2016-07-22, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactoglobulin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02754 (0-161)
  Domains in SCOPe 2.07: d5lkea_
• Heterogens: MYR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lkeA (A:)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi