PDB entry 5lk8

View 5lk8 on RCSB PDB site
Description: single particle reconstruction of slow bee paralysis virus empty particle
Deposited on 2016-07-21, released 2017-01-18
The last revision was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: EM
Resolution: 3.42 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Slow bee paralysis virus [TaxId:458132]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: vp2
    Species: Slow bee paralysis virus [TaxId:458132]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp3
    Species: Slow bee paralysis virus [TaxId:458132]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lk8A (A:)
    mertftpnvmqptpllpttndgrvtfgeafndlkdlarryqlywegtilegnlrairrns
    alvqlplyphglriqpdvnnpiwnimrdghipvissgfryfrgglrlrivveglnscvwv
    qhhpdrpsifsrpiigryiaakdayrnhayaayvqnmsvnrtievevpfyqpglygmlna
    sdnntansfdrlrftglgdlligiegeqpipkegieisvyysiaddfsfnifcgfppmvy
    cdetysaatpdlaqyfedevtiaqpe
    

    Sequence, based on observed residues (ATOM records):
    >5lk8A (A:)
    tpllpttndgrvtfgeafndlkdlarryqlywegtilegnlrairrnsalvqlplyphgl
    riqpdvnnpiwnimrdghipvissgfryfrgglrlrivveglnscvwvqhhpdrpsifsr
    piigryiaakdayrnhayaayvqnmsvnrtievevpfyqpglygmlnaslrftglgdlli
    giegeqpipkegieisvyysiaddfsfnifcgfppmvycdety
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lk8B (B:)
    mdrpegseertvqtsnvvlgetniesqdiaskeysptwdrlassevsdeypmltdrwlfw
    ksvkwevndsafgkmlvqekfpqswvqmdvnvnniprytnipnfipfnihqymradfevk
    iyvnpndfvsgwlimaflyqgsemfdyklrrnpaalmqmphvlvnvgaaneatlkipyry
    vrpfmrckdilrgdnlitgvteplnmgvlfvevlipfrtsaassapksldvslfvkmtna
    kftgmvdgsiallskpialpe
    

    Sequence, based on observed residues (ATOM records):
    >5lk8B (B:)
    ptwdrlassevsdeypmltdrwlfwksvkwevndsafgkmlvqekfpqswvqmdvnvnni
    prytnipnfipfnihqymradfevkiyvnpndfvsgwlimaflyqgsemfdyklrrnpaa
    lmqmphvlvnvgaaneatlkipyryvrpfmrckditeplnmgvlfvevlipfrtsaassa
    pksldvslfvkmtnakftgmvdgsiallskpialp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lk8C (C:)
    dnppdptpakffvpipshswahgtntseptntlrldggvvgvgrsddigtsdtaisgiig
    vygllkpfdwnandtgrnvgghllwsmpvhpqvdkdqviqvmtqskltqyylppisvvss
    lyaytrgsikykflfgnnprhnarllvayipgissdnrltlerarnsahvvfslnevsef
    vftvpyitdtmwwprkyggpqaagefvapsyicmfilnplvamesvpsivtivpmiaagd
    dfevavpaqpavglsrnidviypkdsiisfksgyfpvyvgswhsffdstkailrygavsd
    hiaqlgnipanvnrkafwivvgdtikfktkldkingtewfipegeytlgygvvwrdgaya
    ymvpypltplgekiaqytasllasntaisqirpyipdyivdsaaskdnilwspiedrlra
    qtewvmaepe
    

    Sequence, based on observed residues (ATOM records):
    >5lk8C (C:)
    nppdptpakffvpipshswahgtntseptntlrldggvvgvgrsddigtsdtaisgiigv
    ygllkpfdwnagrnvgghllwsmpvhpqvdkdqviqvmtqskltqyylppisvvsslyay
    trgsikykflfgnnprhnarllvayipgissdnrltlerarnsahvvfslnevsefvftv
    pyitdtmwwprkyggpqaagefvapsyicmfilamesvpsivtivpmiaagddfevavpa
    qpavglsrnidviyp