PDB entry 5lk6

View 5lk6 on RCSB PDB site
Description: Crystal structure of a lipase carboxylesterase from Sulfolobus islandicus
Class: hydrolase
Keywords: Esterase, lipase, Sulfolobus, thermostable, hydrolase
Deposited on 2016-07-21, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha/beta hydrolase fold-3 domain protein
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lk6a_
  • Chain 'B':
    Compound: alpha/beta hydrolase fold-3 domain protein
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lk6b_
  • Chain 'C':
    Compound: alpha/beta hydrolase fold-3 domain protein
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lk6c_
  • Chain 'D':
    Compound: alpha/beta hydrolase fold-3 domain protein
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lk6d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lk6A (A:)
    mpldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseanina
    rvylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfps
    avidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypav
    gfdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliit
    aeydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrt
    fydksaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lk6A (A:)
    pldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseaninar
    vylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa
    vidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypavg
    fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliita
    eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrtf
    yd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lk6B (B:)
    mpldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseanina
    rvylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfps
    avidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypav
    gfdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliit
    aeydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrt
    fydksaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lk6B (B:)
    pldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseaninar
    vylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa
    vidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypavg
    fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliita
    eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrtf
    yd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lk6C (C:)
    mpldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseanina
    rvylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfps
    avidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypav
    gfdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliit
    aeydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrt
    fydksaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lk6C (C:)
    pldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseaninar
    vylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa
    vidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypavg
    fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliita
    eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrtf
    yd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lk6D (D:)
    mpldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseanina
    rvylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfps
    avidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypav
    gfdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliit
    aeydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrt
    fydksaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lk6D (D:)
    pldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseaninar
    vylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa
    vidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypavg
    fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliita
    eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrtf
    yd