PDB entry 5lk4

View 5lk4 on RCSB PDB site
Description: Structure of the Red Fluorescent Protein mScarlet at pH 7.8
Class: fluorescent protein
Keywords: beta barrel, red fluorescent protein, fluorescent protein
Deposited on 2016-07-20, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mScarlet
    Species: Discosoma sp. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LK4 (0-218)
    Domains in SCOPe 2.07: d5lk4a_
  • Heterogens: PG4, PO4, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lk4A (A:)
    avikefmrfkvhmegsmnghefeiegegegrpyegtqtaklkvtkggplpfswdilspqf
    mygsraftkhpadipdyykqsfpegfkwervmnfedggavtvtqdtsledgtliykvklr
    gtnfppdgpvmqkktmgweasterlypedgvlkgdikmalrlkdggryladfkttykakk
    pvqmpgaynvdrklditshnedytvveqyersegrhstg