PDB entry 5lk1

View 5lk1 on RCSB PDB site
Description: structure of hantavirus envelope glycoprotein gc in postfusion conformation in presence of 200 mm kcl
Deposited on 2016-07-20, released 2016-09-14
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelopment polyprotein
    Species: Hantaan virus [TaxId:11599]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08668
      • conflict (114)
  • Heterogens: K, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lk1A (A:)
    setpltpvwndnahgvgsvpmhtdleldfsltssskytyrrkltnpleeaqsidlhieie
    eqtigvdvhalghwfdgrlnlktsfhcygactkyeypwhtakchyerdyqyetshgcnps
    dcpgvgtgctacglyldqlkpvgsaykiitirysrrvcvqfgeenlckiidmndcfvsrh
    vkvciigtvskfsqgdtllffgpleggglifkhwctstcqfgdpgdimsprdkgflcpef
    pgsfrkkcnfattpiceydgnmvsgykkvmatidsfqsfntstmhftderiewkdpdgml
    rdhinilvtkdidfdnlgenpckiglqtssiegawgsgvgftltclvsltecptfltsik
    acdkaicygaesvtltrgqntvkvsgkgghsgstfrcchgedcsqiglhaaaphldkvng
    iseienskvyddgapqcgikcwfvksgewisgifsgnggsddddkagwshpqfekgggsg
    ggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records):
    >5lk1A (A:)
    tpvwndnahgvgsvpmhtdleldfsltssskytyrrkltnpleeaqsidlhieieeqtig
    vdvhalghwfdgrlnlktsfhcygactkyeypwhtakchyerdyqyetshgcnpsdcpgv
    gtgctacglyldqlkpvgsaykiitirysrrvcvqfgeenlckiidmndcfvsrhvkvci
    igtvskfsqgdtllffgpleggglifkhwctstcqfgdpgdimsprdkgflcpefpgsfr
    kkcnfattpiceydgnmvsgykkvmatidsfqsfntstmhftderiewkdpdgmlrdhin
    ilvtkdidfdnlgenpckiglqtssiegawgsgvgftltclvsltecptfltsikacdka
    icygaesvtltrgqntvkvsgkgghsgstfrcchgedcsqiglhaaaphl