PDB entry 5ljy

View 5ljy on RCSB PDB site
Description: Structure of hantavirus envelope glycoprotein Gc in complex with scFv A5
Class: viral protein
Keywords: Hantavirus, Glycoprotein, Viral fusion, viral protein
Deposited on 2016-07-20, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelopment polyprotein
    Species: Hantaan virus (strain 76-118) [TaxId:11602]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: scFvA5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LJY
    Domains in SCOPe 2.08: d5ljyh1, d5ljyh2
  • Chain 'L':
    Compound: scFvA5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LJY
    Domains in SCOPe 2.08: d5ljyl_
  • Heterogens: NAG, NCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ljyH (H:)
    slgamaqvqlqesgpglvkpsetlsltcvvsggsisssnwwswvrqppgkglewigeiyh
    sgspnynpslksrvtisvdksknqfslklssvtaadtavyycarqmrqwgqgtlvtvssg
    gggsggggsggsalsseltqdpavsvalgqtvritcqgdslrsyyaswyqqkpgqapvlv
    iygknnrpsgipdrfsgsssgntasltitgaqaedeadyycnsrdssgnhnvfgggtklt
    vlgaaaddddkagwshpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ljyH (H:)
    qvqlqesgpglvkpsetlsltcvvsggsisssnwwswvrqppgkglewigeiyhsgspny
    npslksrvtisvdksknqfslklssvtaadtavyycarqmrqwgqgtlvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ljyL (L:)
    slgamaqvqlqesgpglvkpsetlsltcvvsggsisssnwwswvrqppgkglewigeiyh
    sgspnynpslksrvtisvdksknqfslklssvtaadtavyycarqmrqwgqgtlvtvssg
    gggsggggsggsalsseltqdpavsvalgqtvritcqgdslrsyyaswyqqkpgqapvlv
    iygknnrpsgipdrfsgsssgntasltitgaqaedeadyycnsrdssgnhnvfgggtklt
    vlgaaaddddkagwshpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ljyL (L:)
    seltqdpavsvalgqtvritcqgdslrsyyaswyqqkpgqapvlviygknnrpsgipdrf
    sgsssgntasltitgaqaedeadyycnsrdssgnhnvfgggtkltvl