PDB entry 5ljh

View 5ljh on RCSB PDB site
Description: Crystal structure of human apo CRBP1/K40L mutant
Class: retinol-binding protein
Keywords: Retinol, Vitamin A, retinol-binding protein, RBP
Deposited on 2016-07-18, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP1, CRBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09455 (Start-134)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d5ljha_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ljhA (A:)
    mpvdftgywkmlvnenfeeylraldvnvalrkianllkpdleivqdgdhmiirtlstfrn
    yimdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlem
    rvegvvckqvfkkvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ljhA (A:)
    pvdftgywkmlvnenfeeylraldvnvalrkianllkpdleivqdgdhmiirtlstfrny
    imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
    vegvvckqvfkkvq