PDB entry 5ljf

View 5ljf on RCSB PDB site
Description: Crystal structure of the endo-1,4-glucanase RBcel1 E135A with cellotriose
Class: hydrolase
Keywords: GLYCOSYL HYDROLASE FAMILY 5, CELLULASE, TIM BARREL, BETA-1, 4-ENDOGLUCANASE, hydrolase
Deposited on 2016-07-18, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C1JI15 (0-320)
      • engineered mutation (134)
    Domains in SCOPe 2.07: d5ljfa_
  • Chain 'B':
    Compound: endoglucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C1JI15
      • engineered mutation (134)
    Domains in SCOPe 2.07: d5ljfb_
  • Heterogens: CT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ljfA (A:)
    svdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpsln
    aelddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakr
    wqghdalfaydimnapygsadklwpaaaqagidgvrkydkkrplliegaswssaarwpry
    adellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkk
    ghigefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqv
    allkkyaakdncsdfgpakae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ljfB (B:)
    svdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpsln
    aelddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakr
    wqghdalfaydimnapygsadklwpaaaqagidgvrkydkkrplliegaswssaarwpry
    adellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkk
    ghigefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqv
    allkkyaakdncsdfgpakae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ljfB (B:)
    vdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpslna
    elddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakrw
    qghdalfaydimnapygsadklwpaaaqagidgvrkydkkrplliegaswssaarwprya
    dellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkkg
    higefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqva
    llkkyaakdncsdfgpa