PDB entry 5liv

View 5liv on RCSB PDB site
Description: crystal structure of myxobacterial cyp260a1
Deposited on 2016-07-15, released 2016-11-23
The last revision was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 CYP260A1,Cytochrome P450 CYP260A1
    Species: Sorangium cellulosum So ce56 [TaxId:448385]
    Gene: sce1588
    Database cross-references and differences (RAF-indexed):
    • PDB 5LIV (Start-49)
    • Uniprot A9FDB7 (50-443)
      • expression tag (444-445)
  • Chain 'B':
    Compound: Cytochrome P450 CYP260A1,Cytochrome P450 CYP260A1
    Species: Sorangium cellulosum So ce56 [TaxId:448385]
    Gene: sce1588
    Database cross-references and differences (RAF-indexed):
    • PDB 5LIV
    • Uniprot A9FDB7 (50-443)
      • expression tag (444-445)
  • Chain 'C':
    Compound: Cytochrome P450 CYP260A1,Cytochrome P450 CYP260A1
    Species: Sorangium cellulosum So ce56 [TaxId:448385]
    Gene: sce1588
    Database cross-references and differences (RAF-indexed):
    • PDB 5LIV
    • Uniprot A9FDB7 (50-443)
      • expression tag (444)
  • Chain 'D':
    Compound: Cytochrome P450 CYP260A1,Cytochrome P450 CYP260A1
    Species: Sorangium cellulosum So ce56 [TaxId:448385]
    Gene: sce1588
    Database cross-references and differences (RAF-indexed):
    • PDB 5LIV
    • Uniprot A9FDB7 (Start-443)
      • expression tag (444-445)
  • Heterogens: HEM, GOL, DMS, SO4, MES, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5livA (A:)
    madekaperehnqgaradgerssgaarrvaafaaalprltlhddlhsvssmdfplanlff
    vpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtatfstrmfqagiln
    gglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlagkprvdlledfam
    elprrvigelfgfpaeklhetdervramlrglvrmhdpaavaesqraygetlglitevve
    resrdtsdtllgeilrtlkaehmdtieasrqivlslilggyettswlvantihallahpd
    tlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtvvclagiagnyd
    etaypspevydidrkplpaanvfgggahfcvgaplarmearvglqallarfpglravpee
    rpsfmygakdsvahgpdklpvllhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5livA (A:)
    ssmdfplanlffvpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtat
    fstrmfqagilngglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlak
    prvdlledfamelprrvigelfgfpaeklhetdervramlrglvrmhdpaavaesqrayg
    etlglitevveresrdtsdtllgeilrtlkaehmdtieasrqivlslilggyettswlva
    ntihallahpdtlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtv
    vclagiagnydetaypspevydidrkplpaanvfgggahfcvgaplarmearvglqalla
    rfpglravpeerpsfmygakdsvahgpdklpvllhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5livB (B:)
    madekaperehnqgaradgerssgaarrvaafaaalprltlhddlhsvssmdfplanlff
    vpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtatfstrmfqagiln
    gglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlagkprvdlledfam
    elprrvigelfgfpaeklhetdervramlrglvrmhdpaavaesqraygetlglitevve
    resrdtsdtllgeilrtlkaehmdtieasrqivlslilggyettswlvantihallahpd
    tlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtvvclagiagnyd
    etaypspevydidrkplpaanvfgggahfcvgaplarmearvglqallarfpglravpee
    rpsfmygakdsvahgpdklpvllhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5livB (B:)
    mdfplanlffvpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtatfs
    trmfqagilngglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlagkp
    rvdlledfamelprrvigelfgfpaeklhetdervramlrglvhdpaavaesqraygetl
    glitevvetsdtllgeilrtlkaehmdtieasrqivlslilggyettswlvantihalla
    hpdtlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtvvclagiag
    nydetaypspevydidrkplpaanvfgggahfcvgaplarmearvglqallarfpglrav
    peerpsfmygakdsvahgpdklpvllhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5livC (C:)
    madekaperehnqgaradgerssgaarrvaafaaalprltlhddlhsvssmdfplanlff
    vpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtatfstrmfqagiln
    gglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlagkprvdlledfam
    elprrvigelfgfpaeklhetdervramlrglvrmhdpaavaesqraygetlglitevve
    resrdtsdtllgeilrtlkaehmdtieasrqivlslilggyettswlvantihallahpd
    tlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtvvclagiagnyd
    etaypspevydidrkplpaanvfgggahfcvgaplarmearvglqallarfpglravpee
    rpsfmygakdsvahgpdklpvllhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5livC (C:)
    mdfplanlffvpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtatfs
    trmfqagilngglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlagkp
    rvdlledfamelprrvigelfgfpaeklhetdervramlrglvrmhdpaavaesqrayge
    tlglitevveresrdtsdtllgeilrtlkaehmdtieasrqivlslilggyettswlvan
    tihallahpdtlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtvv
    clagiagnydetaypspevydidrkplpaanvfgggahfcvgaplarmearvglqallar
    fpglravpeerpsfmygakdsvahgpdklpvllhh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5livD (D:)
    madekaperehnqgaradgerssgaarrvaafaaalprltlhddlhsvssmdfplanlff
    vpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtatfstrmfqagiln
    gglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlagkprvdlledfam
    elprrvigelfgfpaeklhetdervramlrglvrmhdpaavaesqraygetlglitevve
    resrdtsdtllgeilrtlkaehmdtieasrqivlslilggyettswlvantihallahpd
    tlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtvvclagiagnyd
    etaypspevydidrkplpaanvfgggahfcvgaplarmearvglqallarfpglravpee
    rpsfmygakdsvahgpdklpvllhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5livD (D:)
    dfplanlffvpsedatafgrrlraaaqqapivfdtafgmpillrkshittayrdtatfst
    rmfqagilngglaamqgdeharmrrvynmfflpravsqyeerfvrpiseqvvdrlagkpr
    vdlledfamelprrvigelfgfklhetdervramlrglvrmhdpaavaesqraygetlgl
    itevveresrdtllgeilrtlkaehmdtieasrqivlslilggyettswlvantihalla
    hpdtlarvrqdpsllpaaieegmrwcpssfgvlrmverdvrlddqalsagtvvclagiag
    nydetaypspevydidrkplpaanvfgggahfcvgaplarmearvglqallarfpglrav
    peerpsfmygakdsvahgpdklpvllhhh