PDB entry 5lir

View 5lir on RCSB PDB site
Description: Structure of the SALTY Sigma cross-reacting protein 27A (SCRP-27A) from Salmonella typhimurium
Class: transferase
Keywords: Rossmann fold Class I glutamine amidotransferase-like, transferase
Deposited on 2016-07-15, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sigma cross-reacting protein 27A (SCRP-27A)
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: yhbL, STM3327
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZLR6 (24-239)
      • expression tag (21-23)
    Domains in SCOPe 2.07: d5lira1, d5lira2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lirA (A:)
    mhhhhhhitslykkagfenlyfqgkkigvvlsgcgvydgteiheavltllaiarsgaqav
    cfapdkpqadvinhltgeamaetrnvlieaaritrgdirplsqaqpeeldalivpggfga
    aknlsnfasqgsecrvdsdvvalakamhqsgkplgficiapamlpkifdfplrltigtdi
    dtaevleemgaehvpcpvddivvdednkvvttpaymlaqdiaqaasgidklvsrvlvlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lirA (A:)
    fqgkkigvvlsgcgvydgteiheavltllaiarsgaqavcfapdkpqadvinhltgeama
    etrnvlieaaritrgdirplsqaqpeeldalivpggfgaaknlsnfasqgsecrvdsdvv
    alakamhqsgkplgficiapamlpkifdfplrltigtdidtaevleemgaehvpcpvddi
    vvdednkvvttpaymlaqdiaqaasgidklvsrvlvlae