PDB entry 5lil

View 5lil on RCSB PDB site
Description: structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21)
Deposited on 2016-07-15, released 2017-11-15
The last revision was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrolide export ATP-binding/permease protein macB
    Species: Aggregatibacter actinomycetemcomitans [TaxId:714]
    Gene: macB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2EHL8 (20-End)
      • engineered mutation (188)
  • Chain 'B':
    Compound: Macrolide export ATP-binding/permease protein macB
    Species: Aggregatibacter actinomycetemcomitans [TaxId:714]
    Gene: macB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2EHL8 (20-End)
      • engineered mutation (188)
  • Heterogens: ATP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lilA (A:)
    mgsshhhhhhssglvprgshmniieikqlnryfgegenrvhvlkdislsiergdfvaimg
    qsgsgkstlmniigcldtatggsskidgketieltndqlsdlrsqkfgfifqrynllssl
    taaenvalpaiyagmpqsqrlerakqlleklglgdkwqnkpnqlsggqqqrvsiaralmn
    ggeiiladqptgaldshsgenvmeilrqlheeghtiimvthdkhiaasanriieikdgei
    isdtqkrqvksavknpsvfkgrfgfskdqlmeafrmsvsaivahkmrslltmlgiiigit
    svvsvvalgngsqqkilenirgigtntmtifngngfgdrrsrhiqnlkisdantlskqsy
    iqsvtpntsssgilvvgnksftsanlygigeqyfdveglklkqgrllteddvdqsnqvvv
    ldesakkaifanenplgktvifnkrpfrvigvvsdqqlggfpgnslnlyspystvlnkit
    ggsrigsitvkisddvnstvaeksltellkslhgkkdffimnsdtikqtienttgtmkll
    issiafislivggigvmnimlvsvtertkeigvrmaigarqinilqqflieavlicligg
    vagillsvligvlfnsfitdfsmdfstasivtavlfstligvlfgympakkaaelnpita
    laqe
    

    Sequence, based on observed residues (ATOM records):
    >5lilA (A:)
    mniieikqlnryfgegenrvhvlkdislsiergdfvaimgqsgsgkstlmniigcldtat
    ggsskidgketieltndqlsdlrsqkfgfifqrynllssltaaenvalpaiyagmpqsqr
    lerakqlleklglgdkwqnkpnqlsggqqqrvsiaralmnggeiiladqptgaldshsge
    nvmeilrqlheeghtiimvthdkhiaasanriieikdgeiisdtqkrqvksavknpsvfs
    kdqlmeafrmsvsaivahkmrslltmlgiiigitsvvsvvalgngsqqkilenirgigtn
    tmtifqnlkisdantlskqsyiqsvtpntsssgilvvgnksftsanlygigeqyfdvegl
    klkqgrllteddvdqsnqvvvldesakkaifanenplgktvifnkrpfrvigvvsdqsln
    lyspystvlnkitggsrigsitvkisddvnstvaeksltellkslhgkkdffimnsdtik
    qtienttgtmkllissiafislivggigvmnimlvsvtertkeigvrmaigarqinilqq
    flieavlicliggvagillsvligvlfnsfitdfsmdfstasivtavlfstligvlfgym
    pakkaaelnpitala
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lilB (B:)
    mgsshhhhhhssglvprgshmniieikqlnryfgegenrvhvlkdislsiergdfvaimg
    qsgsgkstlmniigcldtatggsskidgketieltndqlsdlrsqkfgfifqrynllssl
    taaenvalpaiyagmpqsqrlerakqlleklglgdkwqnkpnqlsggqqqrvsiaralmn
    ggeiiladqptgaldshsgenvmeilrqlheeghtiimvthdkhiaasanriieikdgei
    isdtqkrqvksavknpsvfkgrfgfskdqlmeafrmsvsaivahkmrslltmlgiiigit
    svvsvvalgngsqqkilenirgigtntmtifngngfgdrrsrhiqnlkisdantlskqsy
    iqsvtpntsssgilvvgnksftsanlygigeqyfdveglklkqgrllteddvdqsnqvvv
    ldesakkaifanenplgktvifnkrpfrvigvvsdqqlggfpgnslnlyspystvlnkit
    ggsrigsitvkisddvnstvaeksltellkslhgkkdffimnsdtikqtienttgtmkll
    issiafislivggigvmnimlvsvtertkeigvrmaigarqinilqqflieavlicligg
    vagillsvligvlfnsfitdfsmdfstasivtavlfstligvlfgympakkaaelnpita
    laqe
    

    Sequence, based on observed residues (ATOM records):
    >5lilB (B:)
    mniieikqlnryfgegenrvhvlkdislsiergdfvaimgqsgsgkstlmniigcldtat
    ggsskidgketieltndqlsdlrsqkfgfifqrynllssltaaenvalpaiyagmpqsqr
    lerakqlleklglgdkwqnkpnqlsggqqqrvsiaralmnggeiiladqptgaldshsge
    nvmeilrqlheeghtiimvthdkhiaasanriieikdgeiisdtqkrqvksavknpsvfk
    gkdqlmeafrmsvsaivahkmrslltmlgiiigitsvvsvvalgngsqqkilenirgigt
    ntmtinlkisdantlskqsyiqsvtpntsssgilvvgnksftsanlygigeqyfdveglk
    lkqgrllteddvdqsnqvvvldesakkaifanenplgktvifnkrpfrvigvvsdqlnly
    spystvlnkitggsrigsitvkisddvnstvaeksltellksmnsdtikqtienttgtmk
    llissiafislivggigvmnimlvsvtertkeigvrmaigarqinilqqflieavlicli
    ggvagillsvligvlfnsfitdfsmdfstasivtavlfstligvlfgympakkaaelnpi
    tala