PDB entry 5lie

View 5lie on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis CYP126A1 in complex with imidazole
Class: oxidoreductase
Keywords: monoxygenase, cytochrome P450, oxidoreductase
Deposited on 2016-07-14, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative cytochrome P450 126
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cyp126, MT0802
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5liea_
  • Chain 'B':
    Compound: Putative cytochrome P450 126
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cyp126, MT0802
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lieb_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lieA (A:)
    mttaaglsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaet
    levlrdpvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmir
    rveddlrrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavepgf
    dfrgsrratmprlnvedagsrlytyaleliagkraepaddmlsvvanatiddpdapalsd
    aelylffhllfsagaettrnsiaggllalaenpdqlqtlrsdfellptaieeivrwtsps
    pskrrtasravslggqpieagqkvvvwegsanrdpsvfdradefditrkpnphlgfgqgv
    hyclganlarlelrvlfeellsrfgsvrvvepaewtrsnrhtgirhlvvelrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lieA (A:)
    lsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrd
    pvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddl
    rrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavvedagsrlyt
    yaleliagkraepaddmlsvvanalsdaelylffhllfsagaettrnsiaggllalaenp
    dqlqtlrsdfellptaieeivrwtspspskrrtasravslggqpieagqkvvvwegsanr
    dpsvfdradefditrkpnphlgfgqgvhyclganlarlelrvlfeellsrfgsvrvvepa
    ewtrsnrhtgirhlvvelr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lieB (B:)
    mttaaglsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaet
    levlrdpvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmir
    rveddlrrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavepgf
    dfrgsrratmprlnvedagsrlytyaleliagkraepaddmlsvvanatiddpdapalsd
    aelylffhllfsagaettrnsiaggllalaenpdqlqtlrsdfellptaieeivrwtsps
    pskrrtasravslggqpieagqkvvvwegsanrdpsvfdradefditrkpnphlgfgqgv
    hyclganlarlelrvlfeellsrfgsvrvvepaewtrsnrhtgirhlvvelrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lieB (B:)
    sgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrdp
    vtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddlr
    rrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavepgfdfrgsrr
    atmprlnvedagsrlytyaleliagkraepaddmlsvvanpalsdaelylffhllfsaga
    ettrnsiaggllalaenpdqlqtlrsdfellptaieeivrwtspspskrrtasravslgg
    qpieagqkvvvwegsanrdpsvfdradefditrkpnphlgfgqgvhyclganlarlelrv
    lfeellsrfgsvrvvepaewtrsnrhtgirhlvvelr