PDB entry 5lid

View 5lid on RCSB PDB site
Description: x-ray structure of a pentameric ligand gated ion channel from erwinia chrysanthemi (elic) in complex with bromopromazine
Deposited on 2016-07-14, released 2016-10-26
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 4.5 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'B':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'C':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'D':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'E':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'F':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'G':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'H':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'I':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Chain 'J':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (153)
      • conflict (278)
  • Heterogens: 6XY

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lidA (A:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5lidB (B:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5lidC (C:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5lidD (D:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5lidE (E:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5lidF (F:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >5lidG (G:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5lidH (H:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >5lidI (I:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >5lidJ (J:)
    pvdvsvsifinkiygvntleqtykvdgyivaqwtgkprktpgdkpliventqierwinng
    lwvpalefinvvgspdtgnkrlmlfpdgrviynarflgsfsndmdfrlfpfdrqqfvlel
    epfsynnqqlrfsdiqvytenidneeidewwirgkasthisdirydhlssvqpnqnefsr
    itvridavrnpsyylwsfilplgliiaaswsvfwlesfserlqtsftlmltvvayafyts
    nilprlpyttvidqmiiagygsifaailliifahhrqangveddlliqrcrlafplgfla
    igcvlvi