PDB entry 5lia

View 5lia on RCSB PDB site
Description: crystal structure of murine autotaxin in complex with a small molecule inhibitor
Deposited on 2016-07-14, released 2016-11-09
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
    Species: Mus musculus [TaxId:10090]
    Gene: Enpp2, Npps2, Pdnp2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, 6XN, ZN, SO4, CA, NA, K, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5liaA (A:)
    aewdegpptvlsdspwtntsgsckgrcfelqevgppdcrcdnlcksysscchdfdelclk
    targwectkdrcgevrneenachcsedclsrgdcctnyqvvckgeshwvdddceeirvpe
    cpagfvrppliifsvdgfrasymkkgskvmpnieklrscgthapymrpvyptktfpnlyt
    latglypeshgivgnsmydpvfdatfhlrgrekfnhrwwggqplwitatkqgvragtffw
    svsipherriltilqwlslpdnerpsvyafyseqpdfsghkygpfgpemtnplreidktv
    gqlmdglkqlklhrcvnvifvgdhgmedvtcdrteflsnyltnvdditlvpgtlgrirpk
    ipnnlkydpkaiianltckkpdqhfkpymkqhlpkrlhyannrriedlhllverrwhvar
    kpldvykkpsgkcffqgdhgfdnkvnsmqtvfvgygptfkyrtkvppfenielynvmcdl
    lglkpapnngthgslnhllrtntfrptlpeevsrpnypgimylqsdfdlgctcddknkle
    elnkrlhtkgsteerhllygrpavlyrtsydilyhtdfesgyseiflmplwtsytiskqa
    evssipehltncvrpdvrvspgfsqnclaykndkqmsygflfppylssspeakydaflvt
    nmvpmypafkrvwtyfqrvlvkkyaserngvnvisgpifdynynglrdiedeikqyvegs
    sipvpthyysiitscldftqpadkcdgplsvssfilphrpdndescnssedeskwveelm
    kmhtarvrdiehltgldfyrktsrsyseiltlktylhtyeseisrenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5liaA (A:)
    wtntsgsckgrcfelqevgppdcrcdnlcksysscchdfdelclktargwectkdrcgev
    rneenachcsedclsrgdcctnyqvvckgeshwvdddceeirvpecpagfvrppliifsv
    dgfrasymkkgskvmpnieklrscgthapymrpvyptktfpnlytlatglypeshgivgn
    smydpvfdatfhlrgrekfnhrwwggqplwitatkqgvragtffwsvsipherriltilq
    wlslpdnerpsvyafyseqpdfsghkygpfgpemtnplreidktvgqlmdglkqlklhrc
    vnvifvgdhgmedvtcdrteflsnyltnvdditlvpgtlgrirpkipnnlkydpkaiian
    ltckkpdqhfkpymkqhlpkrlhyannrriedlhllverrwhvarkpldvykkpsgkcff
    qgdhgfdnkvnsmqtvfvgygptfkyrtkvppfenielynvmcdllglkpapnngthgsl
    nhllrtntfrptlpeevsrpnypgimylqsdfdlgctcddknkleelnkrlhtkgsteer
    hllygrpavlyrtsydilyhtdfesgyseiflmplwtsytiskqaevssipehltncvrp
    dvrvspgfsqnclaykndkqmsygflfppylssspeakydaflvtnmvpmypafkrvwty
    fqrvlvkkyaserngvnvisgpifdynynglrdiedeikqyvegssipvpthyysiitsc
    ldftqpadkcdgplsvssfilphrpdndescnssedeskwveelmkmhtarvrdiehltg
    ldfyrktsrsyseiltlktylhtye