PDB entry 5li3

View 5li3 on RCSB PDB site
Description: crystal structure of hdac-like protein from p. aeruginosa in complex with a photo-switchable inhibitor.
Deposited on 2016-07-14, released 2016-11-23
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetoin utilization protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AO946_14160
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Acetoin utilization protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AO946_14160
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, K, 9RB, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5li3A (A:)
    mtrrtafffdelclwhaagphaltlpvggwvqppaaaghaespetkrrlkslldvsglta
    rlqlrsappasdedllrvhpahylerfkalsdagggslgqdapigpgsyeiarlsaglai
    aaldavlageadnayslsrppghhclpdqamgfcffaniavaieaakarhgvervavldw
    dvhhgngtqaiyyrrddvlsislhqdgcfppgysgaedigedrgrgfnlnvpllpggghd
    aymqamqrivlpalerfrpqlivvasgfdanavdplarmqlhsdsframtamvrdaaerh
    aggrlvvvheggyseayvpfcglavieelsgvrsavrdplrdfielqqpnaafrdfqrqr
    leelaaqfglcpaqplqaar
    

    Sequence, based on observed residues (ATOM records):
    >5li3A (A:)
    rrtafffdelclwhaagphaltlpvggwvqppaaaghaespetkrrlkslldvsgltarl
    qlrsappasdedllrvhpahylerfkalsdagggslgqdapigpgsyeiarlsaglaiaa
    ldavlageadnayslsrppghhclpdqamgfcffaniavaieaakarhgvervavldwdv
    hhgngtqaiyyrrddvlsislhqdgcfppgysgaedigedrgrgfnlnvpllpggghday
    mqamqrivlpalerfrpqlivvasgfdanavdplarmqlhsdsframtamvrdaaerhag
    grlvvvheggyseayvpfcglavieelsgvrsavrdplrdfielqqpnaafrdfqrqrle
    elaaqfglcpaqpl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5li3B (B:)
    mtrrtafffdelclwhaagphaltlpvggwvqppaaaghaespetkrrlkslldvsglta
    rlqlrsappasdedllrvhpahylerfkalsdagggslgqdapigpgsyeiarlsaglai
    aaldavlageadnayslsrppghhclpdqamgfcffaniavaieaakarhgvervavldw
    dvhhgngtqaiyyrrddvlsislhqdgcfppgysgaedigedrgrgfnlnvpllpggghd
    aymqamqrivlpalerfrpqlivvasgfdanavdplarmqlhsdsframtamvrdaaerh
    aggrlvvvheggyseayvpfcglavieelsgvrsavrdplrdfielqqpnaafrdfqrqr
    leelaaqfglcpaqplqaar
    

    Sequence, based on observed residues (ATOM records):
    >5li3B (B:)
    rrtafffdelclwhaagphaltlpvggwvqppaaaghaespetkrrlkslldvsgltarl
    qlrsappasdedllrvhpahylerfkalsdagggslgqdapigpgsyeiarlsaglaiaa
    ldavlageadnayslsrppghhclpdqamgfcffaniavaieaakarhgvervavldwdv
    hhgngtqaiyyrrddvlsislhqdgcfppgysgaedigedrgrgfnlnvpllpggghday
    mqamqrivlpalerfrpqlivvasgfdanavdplarmqlhsdsframtamvrdaaerhag
    grlvvvheggyseayvpfcglavieelsgvrsavrdplrdfielqqpnaafrdfqrqrle
    elaaqfgl