PDB entry 5lhy

View 5lhy on RCSB PDB site
Description: pb3 domain of human plk4 (apo)
Deposited on 2016-07-13, released 2017-03-01
The last revision was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 3.31 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain '9':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK4, SAK, STK18
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >5lhy1 (1:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy1 (1:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >5lhy2 (2:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy2 (2:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >5lhy3 (3:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy3 (3:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >5lhy4 (4:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy4 (4:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >5lhy5 (5:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy5 (5:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '6':
    Sequence, based on SEQRES records:
    >5lhy6 (6:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy6 (6:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '7':
    Sequence, based on SEQRES records:
    >5lhy7 (7:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy7 (7:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '8':
    Sequence, based on SEQRES records:
    >5lhy8 (8:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy8 (8:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain '9':
    Sequence, based on SEQRES records:
    >5lhy9 (9:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhy9 (9:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lhyA (A:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyA (A:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lhyB (B:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyB (B:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lhyC (C:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyC (C:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lhyD (D:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyD (D:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lhyE (E:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyE (E:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5lhyF (F:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyF (F:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5lhyG (G:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyG (G:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5lhyH (H:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyH (H:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5lhyI (I:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyI (I:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5lhyJ (J:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyJ (J:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5lhyK (K:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyK (K:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5lhyL (L:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyL (L:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5lhyM (M:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyM (M:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5lhyN (N:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyN (N:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5lhyO (O:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyO (O:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5lhyP (P:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyP (P:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >5lhyQ (Q:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyQ (Q:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >5lhyR (R:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyR (R:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >5lhyS (S:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyS (S:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >5lhyT (T:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyT (T:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >5lhyU (U:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyU (U:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >5lhyV (V:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyV (V:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >5lhyW (W:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyW (W:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >5lhyX (X:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyX (X:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >5lhyY (Y:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyY (Y:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >5lhyZ (Z:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyZ (Z:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >5lhya (a:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhya (a:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >5lhyb (b:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyb (b:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >5lhyc (c:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyc (c:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >5lhyd (d:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyd (d:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >5lhye (e:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhye (e:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >5lhyf (f:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyf (f:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >5lhyg (g:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyg (g:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >5lhyh (h:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyh (h:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >5lhyi (i:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyi (i:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >5lhyj (j:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyj (j:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >5lhyk (k:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyk (k:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'l':
    Sequence, based on SEQRES records:
    >5lhyl (l:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyl (l:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >5lhym (m:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhym (m:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'n':
    Sequence, based on SEQRES records:
    >5lhyn (n:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyn (n:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'o':
    Sequence, based on SEQRES records:
    >5lhyo (o:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyo (o:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >5lhyp (p:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyp (p:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'q':
    Sequence, based on SEQRES records:
    >5lhyq (q:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyq (q:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'r':
    Sequence, based on SEQRES records:
    >5lhyr (r:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyr (r:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 's':
    Sequence, based on SEQRES records:
    >5lhys (s:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhys (s:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 't':
    Sequence, based on SEQRES records:
    >5lhyt (t:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyt (t:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'u':
    Sequence, based on SEQRES records:
    >5lhyu (u:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyu (u:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'v':
    Sequence, based on SEQRES records:
    >5lhyv (v:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyv (v:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'w':
    Sequence, based on SEQRES records:
    >5lhyw (w:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyw (w:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'x':
    Sequence, based on SEQRES records:
    >5lhyx (x:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyx (x:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt
    

  • Chain 'y':
    Sequence, based on SEQRES records:
    >5lhyy (y:)
    gpmgsaqllksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttryg
    eneklpdyikqklqclssillmfsnptpnfh
    

    Sequence, based on observed residues (ATOM records):
    >5lhyy (y:)
    svfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpdyik
    qklqclssillmfsnpt