PDB entry 5lhx

View 5lhx on RCSB PDB site
Description: PB3 Domain of Drosophila melanogaster PLK4 (Sak)
Class: structural protein
Keywords: Polo box domain, Centriole, transferase, structural protein
Deposited on 2016-07-13, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: SAK, CG7186
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lhxa_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PLK4
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: SAK, CG7186
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lhxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lhxA (A:)
    gpmgqnipikrinvpeigiatelshgvvqvqfydgsvvsvipsmqgggitytqpngtsth
    fgkgddlpfpvrdrvgqipniqlklktapllgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhxA (A:)
    nipikrinvpeigiatelshgvvqvqfydgsvvsvipsmqgggitytqpngtsthfgkgd
    dlpfpvrdrvgqipniqlklktapllg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lhxB (B:)
    gpmgqnipikrinvpeigiatelshgvvqvqfydgsvvsvipsmqgggitytqpngtsth
    fgkgddlpfpvrdrvgqipniqlklktapllgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhxB (B:)
    pikrinvpeigiatelshgvvqvqfydgsvvsvipsmqgggitytqpngtsthfgkgddl
    pfpvrdrvgqipniqlklktapllg