PDB entry 5lhd

View 5lhd on RCSB PDB site
Description: Structure of glycosylated human aminopeptidase N
Class: hydrolase
Keywords: Human aminopeptidase N, CD13, metalloprotease, hydrolase
Deposited on 2016-07-11, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Homo sapiens [TaxId:9606]
    Gene: ANPEP, APN, CD13, PEPN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lhda1, d5lhda2, d5lhda3, d5lhda4
  • Chain 'B':
    Compound: Aminopeptidase N
    Species: Homo sapiens [TaxId:9606]
    Gene: ANPEP, APN, CD13, PEPN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lhdb1, d5lhdb2, d5lhdb3, d5lhdb4
  • Chain 'C':
    Compound: Aminopeptidase N
    Species: Homo sapiens [TaxId:9606]
    Gene: ANPEP, APN, CD13, PEPN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lhdc1, d5lhdc2, d5lhdc3, d5lhdc4
  • Chain 'D':
    Compound: Aminopeptidase N
    Species: Homo sapiens [TaxId:9606]
    Gene: ANPEP, APN, CD13, PEPN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lhdd1, d5lhdd2, d5lhdd3, d5lhdd4
  • Heterogens: NAG, BMA, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lhdA (A:)
    ypydvpdyagaqparspgeknknansspvasttpsasattnpasattldqskawnryrlp
    ntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihskklnytlsqghrv
    vlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefegeladdlagfyrse
    ymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdltalsnmlpkgpstp
    lpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwarpsaiaaghgdya
    lnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyrensllfdplsssss
    nkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgadyaeptwnlkdlmvl
    ndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvlrmlssflsedvfk
    qglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwtlqmgfpvitvdts
    tgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraqndlfstsgn
    ewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiindafnlasahkvpvt
    lalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkkqvtplfihfrnnt
    nnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpnnnpihpnlrstvy
    cnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnrylsytlnpdlirkq
    datstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliqavtrrfsteyelqq
    leqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwftensk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhdA (A:)
    ttldqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviii
    hskklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsef
    egeladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkd
    ltalsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliri
    warpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvty
    rensllfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylga
    dyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgas
    vlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnr
    wtlqmgfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywl
    idvraqndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqii
    ndafnlasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknyl
    kkqvtplfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmen
    pnnnpihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwiln
    rylsytlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndygsfsfsnliqa
    vtrrfsteyelqqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwfte
    nsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lhdB (B:)
    ypydvpdyagaqparspgeknknansspvasttpsasattnpasattldqskawnryrlp
    ntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihskklnytlsqghrv
    vlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefegeladdlagfyrse
    ymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdltalsnmlpkgpstp
    lpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwarpsaiaaghgdya
    lnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyrensllfdplsssss
    nkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgadyaeptwnlkdlmvl
    ndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvlrmlssflsedvfk
    qglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwtlqmgfpvitvdts
    tgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraqndlfstsgn
    ewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiindafnlasahkvpvt
    lalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkkqvtplfihfrnnt
    nnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpnnnpihpnlrstvy
    cnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnrylsytlnpdlirkq
    datstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliqavtrrfsteyelqq
    leqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwftensk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhdB (B:)
    tldqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiih
    skklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefe
    geladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdl
    talsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriw
    arpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyr
    ensllfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgad
    yaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasv
    lrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrw
    tlqmgfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywli
    dvraqndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiin
    dafnlasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknylk
    kqvtplfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenp
    nnnpihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnr
    ylsytlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliq
    avtrrfsteyelqqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwft
    ensk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lhdC (C:)
    ypydvpdyagaqparspgeknknansspvasttpsasattnpasattldqskawnryrlp
    ntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihskklnytlsqghrv
    vlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefegeladdlagfyrse
    ymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdltalsnmlpkgpstp
    lpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwarpsaiaaghgdya
    lnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyrensllfdplsssss
    nkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgadyaeptwnlkdlmvl
    ndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvlrmlssflsedvfk
    qglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwtlqmgfpvitvdts
    tgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraqndlfstsgn
    ewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiindafnlasahkvpvt
    lalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkkqvtplfihfrnnt
    nnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpnnnpihpnlrstvy
    cnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnrylsytlnpdlirkq
    datstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliqavtrrfsteyelqq
    leqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwftensk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhdC (C:)
    ttldqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviii
    hskklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsef
    egeladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkd
    ltalsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliri
    warpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvty
    rensllfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylga
    dyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgas
    vlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnr
    wtlqmgfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywl
    idvraqndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqii
    ndafnlasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknyl
    kkqvtplfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmen
    pnnnpihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwiln
    rylsytlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnli
    qavtrrfsteyelqqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwf
    tensk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lhdD (D:)
    ypydvpdyagaqparspgeknknansspvasttpsasattnpasattldqskawnryrlp
    ntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihskklnytlsqghrv
    vlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefegeladdlagfyrse
    ymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdltalsnmlpkgpstp
    lpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwarpsaiaaghgdya
    lnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyrensllfdplsssss
    nkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgadyaeptwnlkdlmvl
    ndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvlrmlssflsedvfk
    qglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwtlqmgfpvitvdts
    tgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraqndlfstsgn
    ewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiindafnlasahkvpvt
    lalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkkqvtplfihfrnnt
    nnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpnnnpihpnlrstvy
    cnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnrylsytlnpdlirkq
    datstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliqavtrrfsteyelqq
    leqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwftensk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhdD (D:)
    tldqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiih
    skklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefe
    geladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdl
    talsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriw
    arpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyr
    ensllfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgad
    yaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasv
    lrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrw
    tlqmgfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywli
    dvraqndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiin
    dafnlasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknylk
    kqvtplfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenp
    nnnpihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnr
    ylsytlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliq
    avtrrfsteyelqqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwft
    ensk