PDB entry 5lha

View 5lha on RCSB PDB site
Description: Amine transaminase crystal structure from an uncultivated Pseudomonas species in the PMP-bound form
Class: transferase
Keywords: TRANSAMINASE, AMINOTRANSFERASE, PYRIDOXAMINE PHOSPHATE, PLP-DEPENDENT ENZYME FOLD TYPE 1, transferase
Deposited on 2016-07-10, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: omega transaminase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LHA (Start-457)
    Domains in SCOPe 2.07: d5lhaa_
  • Chain 'B':
    Compound: omega transaminase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LHA (Start-457)
    Domains in SCOPe 2.07: d5lhab_
  • Chain 'C':
    Compound: omega transaminase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LHA (Start-457)
    Domains in SCOPe 2.07: d5lhac_
  • Chain 'D':
    Compound: omega transaminase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LHA (Start-457)
    Domains in SCOPe 2.07: d5lhad_
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lhaA (A:)
    mhhhhhhgssyekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvg
    glwnvnighnrasvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlf
    ssggsdavetalkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgql
    lagchlldtpwlyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvi
    vppadywprlrevcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyi
    plgatlfnqriadaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakv
    gaqlleqlqplveryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearrag
    vlvrpignkiilsppltltrdeaglmvsaleaafarcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhaA (A:)
    ekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnr
    asvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdaveta
    lkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpw
    lyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlr
    evcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqri
    adaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqpl
    veryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkii
    lsppltltrdeaglmvsaleaafarcg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lhaB (B:)
    mhhhhhhgssyekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvg
    glwnvnighnrasvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlf
    ssggsdavetalkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgql
    lagchlldtpwlyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvi
    vppadywprlrevcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyi
    plgatlfnqriadaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakv
    gaqlleqlqplveryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearrag
    vlvrpignkiilsppltltrdeaglmvsaleaafarcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhaB (B:)
    kyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnra
    svkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdavetal
    kmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpwl
    yrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlre
    vcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqria
    daiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqplv
    eryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkiil
    sppltltrdeaglmvsaleaafarcg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lhaC (C:)
    mhhhhhhgssyekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvg
    glwnvnighnrasvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlf
    ssggsdavetalkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgql
    lagchlldtpwlyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvi
    vppadywprlrevcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyi
    plgatlfnqriadaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakv
    gaqlleqlqplveryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearrag
    vlvrpignkiilsppltltrdeaglmvsaleaafarcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhaC (C:)
    ekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnr
    asvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdaveta
    lkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpw
    lyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlr
    evcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqri
    adaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqpl
    veryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkii
    lsppltltrdeaglmvsaleaafarcg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lhaD (D:)
    mhhhhhhgssyekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvg
    glwnvnighnrasvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlf
    ssggsdavetalkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgql
    lagchlldtpwlyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvi
    vppadywprlrevcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyi
    plgatlfnqriadaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakv
    gaqlleqlqplveryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearrag
    vlvrpignkiilsppltltrdeaglmvsaleaafarcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhaD (D:)
    kyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnra
    svkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdavetal
    kmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpwl
    yrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlre
    vcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqria
    daiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqplv
    eryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkiil
    sppltltrdeaglmvsaleaafarcg