PDB entry 5lgz

View 5lgz on RCSB PDB site
Description: Structure of Photoreduced Pentaerythritol Tetranitrate Reductase
Class: oxidoreductase
Keywords: PETNR, PETN reductase, FMN, FNR, Photoreduction, OXIDOREDUCTASE
Deposited on 2016-07-08, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lgza_
  • Heterogens: IPA, FNR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lgzA (A:)
    aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
    saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
    asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
    sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
    nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
    aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
    psl