PDB entry 5lgr

View 5lgr on RCSB PDB site
Description: crystal structure of mouse carm1 in complex with ligand p1c3u
Deposited on 2016-07-08, released 2017-03-22
The last revision was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: polyadenylate-binding protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: polyadenylate-binding protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: polyadenylate-binding protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: polyadenylate-binding protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, DXE, PG6, PEG, QVR, LPD, ACE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lgrA (A:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lgrA (A:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lgrB (B:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lgrB (B:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffry
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lgrC (C:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lgrC (C:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lgrD (D:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lgrD (D:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffry
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lgrE (E:)
    fqnmpgairpaa
    

    Sequence, based on observed residues (ATOM records):
    >5lgrE (E:)
    qnmpgairpaa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5lgrF (F:)
    fqnmpgairpaa
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5lgrG (G:)
    fqnmpgairpaa
    

    Sequence, based on observed residues (ATOM records):
    >5lgrG (G:)
    pgairpaa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5lgrH (H:)
    fqnmpgairpaa