PDB entry 5lgm

View 5lgm on RCSB PDB site
Description: gp5.7 mutant l42a
Deposited on 2016-07-07, released 2017-08-16
The last revision was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion protein 5.5/5.7
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: 5.5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03787 (0-68)
      • conflict (41)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lgmA (A:)
    msdylkvlqaikscpktfqsnyvrnnaslvaeaasrghiscattsgrnggaweitasgtr
    flkrmggcv