PDB entry 5lg9

View 5lg9 on RCSB PDB site
Description: structure of pfimp2 (immune mapped protein 2 from plasmodium falciparum) - an antigenic protein
Deposited on 2016-07-06, released 2016-12-07
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0730400
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lg9A (A:)
    eekgaylvfdnasngtlfivwkkekvenalmfikptkevpefkfvnrngknelirnlqsd
    kklfysgicqfvkeakdikgkltllqhfdssfpikvdlyflkgskvmplntgepfvvqdi
    damsvlpkgssslkvktmakdmfvsrgntegasisf