PDB entry 5lg6

View 5lg6 on RCSB PDB site
Description: Structure of the deglycosylated porcine aminopeptidase N ectodomain
Class: hydrolase
Keywords: CD13, pAPN, porcine aminopeptidase N, Coronavirus, hydrolase
Deposited on 2016-07-06, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (Start-944)
      • conflict (88-89)
    Domains in SCOPe 2.07: d5lg6a1, d5lg6a2, d5lg6a3, d5lg6a4
  • Chain 'B':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (Start-944)
      • conflict (88-89)
    Domains in SCOPe 2.07: d5lg6b1, d5lg6b2, d5lg6b3, d5lg6b4
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lg6A (A:)
    ypydvpdyagaqparspeknknaehvpqaptsptitttaaitldqskpwnryrlpttllp
    dsynvtlrpyltpnadglyifkgksivrficqeptdviiihskklnyttqghmvvlrgvg
    dsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgeladdlagfyrseymegnv
    kkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsnmppkgsstplaedpn
    wsvtefettpvmstyllayivsefqsvnetaqngvliriwarpnaiaeghgmyalnvtgp
    ilnffanhyntsyplpksdqialpdfnagamenwglvtyrenallfdpqsssisnkervv
    tviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaeptwnlkdlivpgdvyrv
    mavdalasshplttpaeevntpaqisemfdsisyskgasvirmlsnfltedlfkeglasy
    lhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqmgfpvitvdtktgnis
    qkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqaqndlfktasddwvl
    lnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlald
    ntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwt
    erpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnai
    aqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdats
    tinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqf
    kknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehsvlnwfiehslvprgs
    dykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lg6A (A:)
    itldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviii
    hskklnytmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
    ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
    nmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpn
    aiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenal
    lfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaep
    twnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirml
    snfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlq
    mgfpvitvdtktgnisqkhfllafdylwivpissikngvmqdhywlrdvsqaqndlfkta
    sddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsfnlatahmvp
    vtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqveplfqhfet
    ltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpennpihpnlrst
    iycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylgytlnpdlir
    kqdatstinsiasnvigqplawdfvqsnwkklfqdygsfsfsnliqgvtrrfssefelqq
    leqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lg6B (B:)
    ypydvpdyagaqparspeknknaehvpqaptsptitttaaitldqskpwnryrlpttllp
    dsynvtlrpyltpnadglyifkgksivrficqeptdviiihskklnyttqghmvvlrgvg
    dsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgeladdlagfyrseymegnv
    kkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsnmppkgsstplaedpn
    wsvtefettpvmstyllayivsefqsvnetaqngvliriwarpnaiaeghgmyalnvtgp
    ilnffanhyntsyplpksdqialpdfnagamenwglvtyrenallfdpqsssisnkervv
    tviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaeptwnlkdlivpgdvyrv
    mavdalasshplttpaeevntpaqisemfdsisyskgasvirmlsnfltedlfkeglasy
    lhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqmgfpvitvdtktgnis
    qkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqaqndlfktasddwvl
    lnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlald
    ntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwt
    erpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnai
    aqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdats
    tinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqf
    kknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehsvlnwfiehslvprgs
    dykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lg6B (B:)
    ldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihs
    kklnytmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgeladd
    lagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsnm
    ppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpnai
    aeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenallf
    dpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaeptw
    nlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirmlsn
    fltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqmg
    fpvitvdtktgnisqkhflldssafdylwivpissikngvmqdhywlrdvsqaqndlfkt
    asddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsfnlatahmv
    pvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqveplfqhfe
    tltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpennpihpnlrs
    tiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylgytlnpdli
    rkqdatstinsiasnvigqplawdfvqsnwkklfqdysfsnliqgvtrrfssefelqqle
    qfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehs