PDB entry 5lfu

View 5lfu on RCSB PDB site
Description: myelin-associated glycoprotein (mag) glycosylated and lysine- methylated full extracellular domain
Deposited on 2016-07-04, released 2016-12-14
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 4.3 Å
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myelin-associated glycoprotein
    Species: Mus musculus [TaxId:10090]
    Gene: Mag
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MAN, NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lfuA (A:)
    gsghwgawmpstisafegtcvsipcrfdfpdelrpavvhgvwyfnspypknyppvvfksr
    tqvvhesfqgrsrllgdlglrnctlllstlspelggkyyfrgdlggynqytfsehsvldi
    vntpnivvppevvagtevevscmvpdncpelrpelswlgheglgeptvlgrlredegtwv
    qvsllhfvptreanghrlgcqaafpnttlqfegyasldvkyppvivemnssveaiegshv
    sllcgadsnppplltwmrdgmvlreavakslyldleevtpgedgvyaclaenaygqdnrt
    velsvmyapwkptvngtvvavegetvsilcstqsnpdpiltifkekqilatviyesqlql
    elpavtpeddgeywcvaenqygqratafnlsvefapiilleshcaaardtvqclcvvksn
    pepsvafelpsrnvtvneterefvysersgllltsiltirgqaqapprvictsrnlygtq
    slelpfqgahraaahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lfuA (A:)
    ghwgawmpstisafegtcvsipcrfdfpdelrpavvhgvwyfnspypknyppvvfksrtq
    vvhesfqgrsrllgdlglrnctlllstlspelggkyyfrgdlggynqytfsehsvldivn
    tpnivvppevvagtevevscmvpdncpelrpelswlgheglgeptvlgrlredegtwvqv
    sllhfvptreanghrlgcqaafpnttlqfegyasldvkyppvivemnssveaiegshvsl
    lcgadsnppplltwmrdgmvlreavakslyldleevtpgedgvyaclaenaygqdnrtve
    lsvmyapwkptvngtvvavegetvsilcstqsnpdpiltifkekqilatviyesqlqlel
    pavtpeddgeywcvaenqygqratafnlsvefapiilleshcaaardtvqclcvvksnpe
    psvafelpsrnvtvneterefvysersgllltsiltirgqaqapprvictsrnlygtqsl
    elpfqga